5XTC


Conserved Protein Domain Family
Ndufs5

?
pfam10200: Ndufs5 
Click on image for an interactive view with Cn3D
NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
This is a family of short, approximately 105 amino acid residue, proteins which form part of NADH:ubiquinone oxidoreductase complex I. Complex I is the first multisubunit inner membrane protein complex of the mitochondrial electron transport chain and it transfers two electrons from NADH to ubiquinone. The protein carries four highly conserved cysteine residues but these do not appear to be in a configuration which would favour metal binding so the exact function of the protein is uncertain.
Statistics
?
PSSM-Id: 370878
View PSSM: pfam10200
Aligned: 6 rows
Threshold Bit Score: 182.343
Threshold Setting Gi: 47117291
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XTC_HH    1 PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRK 80 
Q0MQH4     2 PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRK 81  chimpanzee
Q02379     2 PFFDVQKRLGVDLDRWMTIQSAEQPHKIPSRCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLHAIRR 81  cattle
Q502P6     2 PFIDLQSKLGINVDKWLLAQSGEQPRKRAAFCHAFEKEWIECSHAIGKTRASKECNIEWEDFYECMHRFKTMKRLKEIST 81  zebrafish
CAF96329   2 PFVDLNKRLGVNLDHWILTQSGPQPHQRAARCHVFEKEWIECSHGIGQTRAKKECQLEFEDFYECLHRQKTHQRLQAIRQ 81  spotted green puffe...
Q99LY9     2 PFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKK 81  house mouse
5XTC_HH   81 QRDKLIKEGKYTPPP 95 
Q0MQH4    82 QRDKLIKEGKYTPPP 96  chimpanzee
Q02379    82 QREKLIKEGKYTPPP 96  cattle
Q502P6    82 QKEKMIKEGTYTPPP 96  zebrafish
CAF96329  82 QRDKMVKEGTYTPPP 96  spotted green pufferfish
Q99LY9    82 QREKLMKEGKYTPPP 96  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap