Conserved Protein Domain Family
Telomere_reg-2

?
pfam10193: Telomere_reg-2 
Telomere length regulation protein
This family is the central conserved 110 amino acid region of a group of proteins called telomere-length regulation or clock abnormal protein-2 which are conserved from plants to humans. The full-length protein regulates telomere length and contributes to silencing of sub-telomeric regions. In vitro the protein binds to telomeric DNA repeats.
Statistics
?
PSSM-Id: 401998
View PSSM: pfam10193
Aligned: 152 rows
Threshold Bit Score: 84.0792
Threshold Setting Gi: 309362017
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KDE06835             688 PVYVAELTAYLKgldpegkkeeVD-QEVERVEVGLREGEGLVR-RKKGwggELEE-NAVDLAFALMGL---QDQY--DIE 759  Microb...
XP_015795552         477 PIYVVDCISGLR----------DV-ENCDWNQICLKSTMEIID-KNAS---MIED-YAEDFAISLLNL---QDTF--ETP 535  two-sp...
WGS:AFBI:EDEG_00944  292 pYSVQQCLKALE----------NP-KNKDNLETTLKLIPNILN-KTSK---RVLErYSCKLFYSILNI---SEEY---LK 350  Edhaza...
Q22HE2               362 PKHLYDCLLGLR-----------S-DNSKRFELSLKHLNFLIR-KNVD---DLAV-LWEELTNQLLRI----HQIdvWIP 420  Tetrah...
CDS40641             537 PHYLRECLDGLGgak----hnpDDiASNEVALSCFAHAEELIYrHCGG---AVHE-VAAIFADTLLHT---EPPIcpYIE 605  Echino...
EFA82729             610 KLYLRDCMMEFQ----------TNkHTAESWESALISIASIVW-SNPD---DLDE-LSESVTKSLLHL---TNEY--GVD 669  Hetero...
EGG14925             582 KLYLMDCLMEFQ----------TNkHTPESWESALTSISSIVWnSKPD---DLDE-FSVPLTRSLLHL---ANEY--GLE 642  Cavend...
XP_003285130         597 KIYLRDCLLELQ----------SSkHTAESWENSLFSISKIVW-SNPD---DLDE-LAQPLASSLLHL---SNEY--DLD 656  Dictyo...
Q54J89               603 KIYLRDCLLELQ----------SQkHTAESWENALNSISNIVW-SLPD---DLDE-LSVQLANSLIHL---TNEY--DLE 662  Dictyo...
RRT80661             261 fsqlGDIAAALR----------KP-DDPDGVERALDSAEKLVR-ATPD---ELPH-YSGDLVRALVHVrcsDVTVegEED 324  Ensete...
KDE06835             760 GFEHSKRKIIIALVAACPTKVAPCIIEQYFTPSYSVVQRYTMLTALALG 808  Microbotryum lychnidis-dioicae p1A1 L...
XP_015795552         536 DFVTLRRDALVKLLTVSPITVATYLTGQFYDNNLDIERRLLILETLAMA 584  two-spotted spider mite
WGS:AFBI:EDEG_00944  351 KSRKPRNSVLVLLAKLDFNNISNFCINNLFENRLCLASKILIIQIISei 399  Edhazardia aedis USNM 41457
Q22HE2               421 QFDEYKKRALVSLCIFKPEQVSKVLIDRFFSAESYVGDKHFLINLFIES 469  Tetrahymena thermophila SB210
CDS40641             606 EVNASRHRALVALAVVSPRRTVHYLTGQLMQSGLAVNQLSAVIAALTDA 654  Echinococcus multilocularis
EFA82729             670 NFEVVRHEALVALAVNSTKIVVKYLTDCFYQNTFSLGQRLEILSVLTDA 718  Heterostelium album PN500
EGG14925             643 NFEVIVQESIVALAIHSTGPVVDYLTSTFSKPNYSIGQRLTILSTLIDT 691  Cavenderia fasciculata
XP_003285130         657 GFSQHRHEALVALATQSPAIVVPFLTNSFKESNFSVGQRLEILDTIAES 705  Dictyostelium purpureum
Q54J89               663 SFSSIRHESLVSLATQSTSLVIPYLTDAFKQKNFSIGQRIEILETISES 711  Dictyostelium discoideum AX4
RRT80661             325 SAEGKRQKALVALLVTCPFESLDVLTRLLYSPNVDVSQRILILDVMTEA 373  Ensete ventricosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap