Conserved Protein Domain Family
Oscp1

?
pfam10188: Oscp1 
Organic solute transport protein 1
Oscp1 is a family of proteins conserved from plants to humans. It is called organic solute transport protein or oxido-red- nitro domain-containing protein 1, however no reference could be find to confirm the function of the protein.
Statistics
?
PSSM-Id: 401994
View PSSM: pfam10188
Aligned: 32 rows
Threshold Bit Score: 200.878
Threshold Setting Gi: 300255861
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023816045  18 LYILDQRLQAQNTSVDNTEkgvwsekdrkRVMNDIIGTMFSKAFMDELLKPQQly-----sHKTMKTVLTRLAHTSIMRL 92  Japanese medaka
EFJ40144      18 IFVIEQRLKATGVSADNQA----------KVLSEMVAYVFGGKSAASILQPDF--------QKETREVVVAMCNCSIMKL 79  Volvox carteri ...
XP_012547045  18 IFVIDQRLKAQNIAMEKCE----------KVLTDIVTVLLHPKLLDELFIPQPva-----tQTVVKQLLEDISTTSIMRL 82  domestic silkworm
OWR48938       2 IYVIDQRLKTQSVPLEKSE----------RVMTDLVTVLLHPKLLDELFLPQPva-----tHKVIKQLLQDICETSIMKL 66  Danaus plexippu...
Q17E07         2 LYVIDQRLKAQAIPLDKSA----------QVLREITEVLLDPKFLHYISTAYQhnm---ltVQQTRILLTDIACCSLMRL 68  yellow fever mo...
EDW47496      27 LYVIDQRLKAQQIAQDKSV----------QVIHDVTSVLLEPKFIDSLLNGSKhnsaqlltAEHCKFMLNDIATCSLMRL 96  Drosophila sech...
EGI62818      18 LYVLRQRLKAQKIDVDKTV----------QVLDDVTAALLNPKILSPIFEDSPmi-----gISELRTTLESVALSSIMKL 82  Panamanian leaf...
XP_001600096  18 LYVLQQRLKTQKIGSDKTI----------QVMNDVIHALLNPQQLHEIFDKVPlm-----sLLSLRAILERVVLSSIMRL 82  jewel wasp
XP_016660664  18 IYVVAERLKTQKIQIDKSK----------LVLNDIIAASLNCPF---LFVPTSii-----nKDILNKSICSAVHSSIMRL 79  pea aphid
Q23K37        20 IYILSQRLIAQKVDPVKTV----------QVLNDILRSLFSQQLFTELMKPQKvm-----qMSFFKTLITKMVHCSIMKL 84  Tetrahymena the...
XP_023816045  93 NPASMEKLYELMVMAFKYQVYLC-PRPKDLLLITYNHMDAIREFVR--DTPAv---aNQVDETHRKLIEVYAPLSEGEFQ 166 Japanese medaka
EFJ40144      80 DGSSMDKLFDLAVMMVKYKIMCS-KTLEQIVEISLLHLDQVEDIIRrhVAGGggaaaADVASTRRQVKSMYDKLGPGELH 158 Volvox carteri ...
XP_012547045  83 DEYSLSKLWDLMTMIYKWQLSTA--TIQNIFDISRRHLRSVAALMPrnYSK------DIIENAIKRFGILAQDLSDEDYK 154 domestic silkworm
OWR48938      67 DDYSKSKLWDLMTMLFKWQLSVA--TTQNVFDISKRHLRNVMTLMPeyFSK------FIFENALNKFEKLIDKFSDNDFH 138 Danaus plexippu...
Q17E07        69 DVNSMDKLWDLMIMIFKWQMYLTnKSAQAMMDLTFRHLDGIGRLIPemKKQ------ILIDNVKKSLIEMWEPLCEDDQT 142 yellow fever mo...
EDW47496      97 DEQSMSKLWNLMTMVYKWQLFVS-RHQHHLLEITFRHLDAINRLYPdaKRH------MLIDFTKNTLLDFWNASGEDAQL 169 Drosophila sech...
EGI62818      83 DRSSMDKLFDLMIMMVKYQLRVA-TGPREIILITLNHIDGMRDIVNnvNAQ------KCVNMVHQMVVSFYGCLTFEEVW 155 Panamanian leaf...
XP_001600096  83 DDNSMNKLFDLMIMMVKYQLVTA-SGPREVFLSTLNHLDALRDMAAidRTLG-----KHIDFTYQLLLDTYGQMNHKEIW 156 jewel wasp
XP_016660664  80 NDSSMEKLMGLIETSVKMQMFSS-NGPRQVLLVTLNHLDSIRELACthQLK------HNIDVIQHNFYQTFEKMTNGEIM 152 pea aphid
Q23K37        85 NEASMQKLIDLILMDFKAQIVNT-MHPAELYDVTQNHFNGIINIMKngPAV------EYLIYVQKKFEEIYSPMLPFDFL 157 Tetrahymena the...
XP_023816045 167 LLRQTLLIFFQDMHVRVSLFLKNQIQNPNGRFT 199 Japanese medaka
EFJ40144     159 RIRQVLLAELQGQRVKISLLLSANIQNTDATFK 191 Volvox carteri f. nagariensis
XP_012547045 155 CLSNTVIFWFNQYHAKISVLLRLDLQRKDGTFC 187 domestic silkworm
OWR48938     139 CLCTTLILWFSEYHTKISVLIRLGLQKKDGTFS 171 Danaus plexippus plexippus
Q17E07       143 IVHRRVYKWLKPYTTKISILIRMGLQKSDGEFE 175 yellow fever mosquito
EDW47496     170 SIYQTNRAWLQCFNTKISLLIRMGFQAMDGSFI 202 Drosophila sechellia
EGI62818     156 NVRESCLKELEPYHVRVSILLRRGLQNDDASFN 188 Panamanian leafcutter ant
XP_001600096 157 QIRTECLRQIRNHNVRVSILLRLGMQNQDASFN 189 jewel wasp
XP_016660664 153 RIRYAMLNYLQDIHVKVTIFIKEGLQRYNGSFV 185 pea aphid
Q23K37       158 QIKIELLTFLQDVKQKVYVFIEDKTQNQNGDIR 190 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap