Conserved Protein Domain Family
C6_DPF

?
pfam10170: C6_DPF 
Cysteine-rich domain
This is the N-terminal approximately 100 amino acids of a family of proteins found from nematodes to humans. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed.
Statistics
?
PSSM-Id: 401978
View PSSM: pfam10170
Aligned: 31 rows
Threshold Bit Score: 110.386
Threshold Setting Gi: 300261739
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003137814  30 FTCFLCGLTENCRYGLVEVSGrTHNYRYKDEMYYMLDPFRNRNTvnerrltrtkantcsktsgsktasilDILVLGAICS 109 eye worm
EFN87745       9 FACSFCSLKEHYDYKGTRPPF-ARQLVYLEECYVMKDPFSLPSRg-------------------------EVLVLGGDCS 62  Jerdon's jumpin...
XP_003244737  58 FVCKNCNLTERYDCFNDHVSF-NRKVGTKVDYYLARDPFSPRSKr-------------------------QFLILGSVCS 111 pea aphid
XP_001900545  30 FTCFLCGLTENCRYGLVEVSGrTHTYQYKDEMYYMLDPFRNRNVnerrltrtktdid-nkpsgsktanifDILVLGAICS 108 Brugia malayi
EFJ45950       2 FACSLCGFEAPFKHFGASLPS-VCS--FLEEGWLAVDPFSIQAR---------------------------PVFLGAPCS 51  Volvox carteri ...
EFX74840      18 FQCALCGWSERYHGHGTSLPF-ARGINFNEDAYVMRDPFVPYAQn-------------------------LYFFLGAPCS 71  common water flea
XP_002000943  50 FHCSGCNMHEMVHYYGRTPPF-ALGIKFREDSYVLRDPFQAPPPrwqs-------------------kpeFYVALGVKCA 109 Drosophila moja...
XP_004343823  38 tQCSLCAHPVPYDYTGKTPPF-APRVVFLEDVFAIRDPFAVAAQtaslaa---------------aslpkRCLAMGARCA 101 Capsaspora owcz...
EEH55089      21 FECKCCGIEINYEYKGRTPPY-EPSIVFLEDGYFRRDPFADVKR---------------------------PLFIGADCN 72  Micromonas pusi...
ESO00108       6 FFCFFCKVSVKFDYFGKDPSF-FKNINVKEDVYIMRDPFTNERN--------------------------SYIILGSHCS 58  Helobdella robusta
XP_003137814 110 ICGQPVCIGedCGVFYAKAFCIVCINREKAHFPKNFIEQID 150 eye worm
EFN87745      63 TCGHAVCLG--CSIFYTKRFCPKCASSNMHNLPNKLHGKIS 101 Jerdon's jumping ant
XP_003244737 112 MCDKDVCIKpeCSIFYSKFFCSICARKYISNFPTSIQEKIK 152 pea aphid
XP_001900545 109 ICGQSVCIDedCSVFYTKTFCIICVNREKTHFPKSFVEQID 149 Brugia malayi
EFJ45950      52 ACGRAVCTAeaCSVFYSKRFCRPCARSNAEAFPAAVRKaap 92  Volvox carteri f. nagariensis
EFX74840      72 ACQRLVCAN--CSLFYSKRFCGECANKNVQHFPVEVQKKIH 110 common water flea
XP_002000943 110 NCNKVVCKDtlCSFYYTKTFCLECGKVELKNWPVEAQSRFR 150 Drosophila mojavensis
XP_004343823 102 ECNRIVCMQatCSLFYQKRFCALCAKQWANCFPSQLKPDLE 142 Capsaspora owczarzaki ATCC 30864
EEH55089      73 VCSRPVCAQptCSLFFTKRFCAACAKQYAEGFPLELRPDLE 113 Micromonas pusilla CCMP1545
ESO00108      59 SCQKVVCVStdCSLFYCQRYCLPCSLENFDVFPKEIQvlfl 99  Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap