Conserved Protein Domain Family
Nup88

?
pfam10168: Nup88 
Nuclear pore component
Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein has no obvious structural motifs but is the region for binding to Nup98, one of the components of the nuclear pore. the C-terminal end is a predicted coiled-coil domain. Nup88 is overexpressed in tumor cells.
Statistics
?
PSSM-Id: 401976
View PSSM: pfam10168
Aligned: 17 rows
Threshold Bit Score: 827.377
Threshold Setting Gi: 193610821
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEN52725             11 NVLNDHPLFLHLRRG-------ESDGKSNRT----------------EARGLVVVQDGDIYAWNGRNSTLVTANLKTllq 67  Florida ...
2_pfamImport          1 NVLDGHKIFEQDPVPl------GSPNEGGSE----------------KVKQLLHIDGGNLFVWNESRSCLMTTNLRS--- 55 
Q3SZ56               16 TWLPNHAVFLRLREGl------KNQSSTETEkpasslpsspplppqlLTRNLVLGLGGELFLWDPEESSFLVVRLRGps- 88  cattle
XP_006640886         11 SELPGHDLFTKLRENl------DRDFRGSGRt---------------PAKNLAFCLNGDLFVWDEANSVFYTTNLRQld- 68  spotted gar
XP_003459163         11 NDLPNHTIFKIIREKl------DLERTSSERg---------------IAKNLTFCLGADFFVWDDSDRVFYTTNLRQln- 68  Nile til...
A2CEI4               11 EALKNHDIFNNLQERl------HLEPQGTSKr---------------IAKNLTFCLNGDLFIWDSVESVFYTTNLRQln- 68  zebrafish
EKC41573              9 TCLNELKIFKQLRENn------CTDSIQKRKl---------------HSKSLVQVLDSDVYVWDGYAAQLLNYNLKNf-- 65  Pacific ...
XP_001949727          8 LNLNKLEMFQTMRKVl------ETDGANTV-------------------RNLIAYKDQILYIWNPDECCLYSLLLNTv-- 60  pea aphid
WGS:AAPP:GF17877-PA   7 FELNKAKLFEKIRHGl------P-IVQKT--------------------QNLLDCKDDLLFAWDAKDCCLLVRNWRTplt 59  Drosophi...
NP_001016790          9 SSLSEHALFSRLKERtreveelREEGERRTRkd-------------kQLRNLLCVLDGDLLVWDSEECAFLTVRLRSl-- 73  tropical...
EEN52725             68 deaEVEKRPLKFQTLLCTDPPLSDVHHVKFSLTGNHVALWGPGGVSIMEVPRRWGKHAEFEGGKD---KVNCRSYPVAER 144 Florida ...
2_pfamImport         56 ---SLDGNKSNIQTLCCQNAPLFEVNKITFNCTSSHLALVGTRGVTVLALPRRWGKEAEYEGGKP---KIICRSSPVAER 129
Q3SZ56               89 -gaGEEPSLSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMILELPKRWGKNSEFEGGKS---TVNCSTTPVAER 164 cattle
XP_006640886         69 -vsDG----ANYQTLMCINPPLFEVYQVLLSPTQYHVALIGRRGASVLELPQRWGKRSEFEGGRP---RINCKTIPVAER 140 spotted gar
XP_003459163         69 --tEESSSSGKYQTLLCINPPLFEVCQVLVSPTQHHVALVGQRGVSVLELPLRWGKRSEFEGGRS---KINCKTIPVAER 143 Nile til...
A2CEI4               69 --sDGEPDTSRYQTLLCINPPLFEVCQVLVSPSQYHVALIGQRGATVLELPQRWGKKSEFEGGRI---QINCKTIPVAER 143 zebrafish
EKC41573             66 --sDSPDKKSRSQTLLCTDPPRFDVDGIDFNQSKSFLAIWGSSGVMVLEMPQRWGKYSEFEGGKP---AVTCKTTSVAEH 140 Pacific ...
XP_001949727         61 -----HEEQPSYQKLFPGSPPLFDVDEILINEPGTLCALVGSKGVSVMRFPKRMGSKSLYDTSGSlgeGITCSTSLLQDK 135 pea aphid
WGS:AAPP:GF17877-PA  60 eaaGAKLAGVQFQTLIPSNTVSLDVDRVLVSNEGSLVALSGEHGVCVLELPRRWGQDGYYKDGKE---RITCRSFSLDSQ 136 Drosophi...
NP_001016790         74 --sVESTGSSGEQKLLCTNPPLFEVNEVLLSPTQHHVALVGSKGVMVLEIPKRWGKKSEFEGGEK---TVNCRAIPIAER 148 tropical...
EEN52725            145 LFATQSSLQLLQVDWHPGSPSD-THLVILTSD-NVLRIYD-IEKPDSPYQSFQLGEFAD--SFSLHSTSSATFNQA-LGE 218 Florida ...
2_pfamImport        130 FFMSNISIQLIQASWYPSTSSQhPHLCLLTSD-NMLRIYSaTADTQTPIQTHKLNQVSDmnNTSLTASRASLLSISvLGE 208
Q3SZ56              165 FFTSSTSLTLKHAAWYPSEMLE-PHIVLLTSD-NVIRIYS-LREPQTPTKVIVLSEAEE--ESLILNKGRA-YTAS-LGE 237 cattle
XP_006640886        141 FFTSSGSVILRDVAWYPSETEE-PHLVLLTSD-NTLRFYN-LKEPQSPARVLCLSQCEE--ENAVRTQGRS-YAAS-LGE 213 spotted gar
XP_003459163        144 FFTSSPSVSLRQAAWYPSETDE-PHMVLLTSD-NTIRFYG-LKSPQTSAKILPVSQSED--ESSLHPPVRS-YAAS-LGE 216 Nile til...
A2CEI4              144 FFTSSASVTLRQAVWYPSETEE-PHLVLLTSD-NTIRFYN-LKEPQSPARVLSVSQMDD--DSSVHTRSRS-YAAS-LGE 216 zebrafish
EKC41573            141 YFTSHKSVQLLQVAWHPGSETD-SHMTLLTSD-NLLSTYD-LREPDVPIHIVTLGDSLQ--DLTDSPSKTS-YRAA-LGD 213 Pacific ...
XP_001949727        136 FFITKHLTDVKRVRWYPGSPED-NHLVVLTNNkNCLRLF---KVDKGTGKLVSIWRLGPqtSRILAS----------LGD 201 pea aphid
WGS:AAPP:GF17877-PA 137 LFLSSPQLEVRQVRWHPHSVSD-STLLVLLNN-NTIRVY-------NHSKLRHVWQVGP--SILRAGGNSSLTDF---GE 202 Drosophi...
NP_001016790        149 IFTSSTSLVLKQALWYPSETQE-PHLILLTSD-NILRLYN-LHDPLTPEKVISLSSAEE--ETTLPHNGRS-YKAS-LGE 221 tropical...
EEN52725            219 TAVSFTFAPPVD-MPVQekmkwKSDQTR--------------KTETM-Y-PVFVLRGNEDVYYLLTSLEQKSPKVS---L 278 Florida ...
2_pfamImport        209 TVVAFDFAPVIEhTPST-----ISNLRK--------------KPEPIsLqPIYLLQGNGDVLLLLTSLTDNKFSRGi--F 267
Q3SZ56              238 TAVAFDFGPLSA-VPKH-----IFGQKG--------------KEEVAaY-PLYILYENGETFLTYISLLHSPGSVGk--L 294 cattle
XP_006640886        214 IAVAFDFGPLGC-APRQ-----LLGQRV--------------KEEVLaY-PLYILYENGETYLTYISLAHSGGSLGk--P 270 spotted gar
XP_003459163        217 IAVAFDFGPISS-PPRQ-----LPGQVS--------------KDQLV-Y-PLYILYENGETYVSYTSQVNGI-SLSk--P 271 Nile til...
A2CEI4              217 TAVAFDFGPLAD-SP-H-----LSSLRM--------------KAELVvY-PLYILYGNGETFLNYISLSHSVGSLGk--P 272 zebrafish
EKC41573            214 VAASFDFGP-----PVElkrknRFHSTL--------------TSPDVvW-PAYIVFGNGDVVIAYTDLSPDPSSIQklsL 273 Pacific ...
XP_001949727        202 TAVDFDFAPPVL----------LGSRIQ--------------SDPSImW-PILVLQGNGDVLCMNTTVDESM-NIKsakI 255 pea aphid
WGS:AAPP:GF17877-PA 203 VAVDFDVAPAGKpKESEpledkNN--TLnqnnkslqnkkcnvNQEKIeW-PVIVLRENGNIYVLLTGLDSEMTR-----L 274 Drosophi...
NP_001016790        222 TAVACDFGPLTP-LPKG------FGQYN--------------KEDTVaY-PLYILYETGETYLMYIDLQKSNIKVGk--L 277 tropical...
EEN52725            279 QGPLTMHPPADDNYGIDACSILCLPCNPPLVVIATTTGRLYHCIVL---QGEEEDDDRRSEvswtgsDVSTrdtqdMPep 355 Florida ...
2_pfamImport        268 HGPLIMLPPAEDNYGVDSCSIIVMDTSPTTIAIATAAGKLHHCVALwvtDADDISVTSHHK------GDLT-----PP-- 334
Q3SZ56              295 LGPLPMHPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVL---EGEEEDDQTSEKswd-srADLI-----P--- 362 cattle
XP_006640886        271 LGPLPMHPAAEDNYGYDACAVLCLPCVPNILVIATETGTLYHCVVL---EAEEDEEAGAGErwa-rgSEAV-----P--- 338 spotted gar
XP_003459163        272 VGPLPMYPAAEDNYGYDACAILCLPCVPSILVIATETGTLYHCVVL---ESEEEDDTGAVEkwi-rgTETV-----P--- 339 Nile til...
A2CEI4              273 MGPLPMYPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVL---EAEEEEDGGAVErws-rgSETA-----P--- 340 zebrafish
EKC41573            274 QGPLVMLPPAEDNYGVDACSIAVLGTVPSVLVIGTRDGKLHHCLVM---QSSLEDTNLQSEtqsvisTDTSllyeaPDdv 350 Pacific ...
XP_001949727        256 TGPLTMYPPADDNYSEDACSILVMDTIPPSVVIASNFGELYNCLLLpdtQAKNEDEYESSEy--------------QHey 321 pea aphid
WGS:AAPP:GF17877-PA 275 QGPITITPQVQDNYGLESCALMVIPSLPPTIVIAESNGKIHHALLM---EAEATE-----Hsfs-evDDFLli--ePSqy 343 Drosophi...
NP_001016790        278 LGPLPMYPAAEDNYGYDACAVLCLACVPNIIVIATESGLLYHCVVL---EGEDDDEQTSNKswn-ssCDLI-----P--- 345 tropical...
EEN52725            356 SLYVYESVELELSLGGTPDdIDSYpdyqpdncpIRLHPDPSSDGRYHCSHAMGVHSVALPWINKLHRFSQSDEEDKDSLL 435 Florida ...
2_pfamImport        335 TLYVYETVELELDLLDEDVpENHH---------IILHKDSTLLTRYHCSTSVGVHSVALPWLNKMDAFIRAVEDDRDHLG 405
Q3SZ56              363 SLYVFECVELELALKLASG--EDEpfdsdfscpIKLHRDPKCPSRYHCTHEAGVHSVGLTWIHKLHKFLGSDEEDKDSLQ 440 cattle
XP_006640886        339 SLYVFECVELELTLKVAAGrEEEEalesdftcpIRLHRDPLCQQRYHCTHEVGVHSVGLTWVNKLHKFLQSDEEDKDSLQ 418 spotted gar
XP_003459163        340 ALYVFECVELELILKVATG-EDEEpqefdftcpIKLHRDPLCQHRYHCTHEAGVHSVGLIWVNKLQRFLKSDEEDKDSLQ 418 Nile til...
A2CEI4              341 SLYVFECVELELTLKLPAG-EEEEitesdftcpIRLHRDPLCQHRYHCTHEAGVHSVGLTWFKKLHKFLESDEEDKDSLQ 419 zebrafish
EKC41573            351 SLYVYESVELELSLTTTSL-KTEEfiedtftcpIKIIKDPMAPDRYHCIHSAGVHTIVLPWIQEYQKFFADSE------- 422 Pacific ...
XP_001949727        322 SLHIIETIELELGLNVEDNgEYDTsn------tIQLKRDAAVTSRYWCLHNTGVHSVTVPLSELLDEFSKT--NPDDFRG 393 pea aphid
WGS:AAPP:GF17877-PA 344 VIHVLETVKLELGLAAPS----RKgve----npIYLKRDLINELRYFAYHDAGLHVVSVSFIAELQRYLES-ESQEDRL- 413 Drosophi...
NP_001016790        346 SLYVFECVELELALKLAT--EEEEsmeldfscpIKLHRDPICPSRYHCTHVAGVHSVGLAWFNKLEKFLGSGEEDKDSLQ 423 tropical...
EEN52725            436 ELSRDQPCIVEHLVCTRPVPSSPPAPILGLTVVGdqlLGPT-LLCLTSDVTCIALPL---------LTHY-----ANPPP 500 Florida ...
2_pfamImport        406 DLAHDDPCVVEHVLCTKPTLSASPCPIIGITIATdaiFGPT-LLCLMADNHCTTVPL---------LNTF-----VPTSP 470
Q3SZ56              441 ELATEQKCFVEHILCTKPLPCRQPAPIRGFWIVPd-iLGPT-MICITSTYECLIRPL---------LSTV-----HPASP 504 cattle
XP_006640886        419 ELAAEQRCMVEHILCTRPLSSSSSAPVRGFWIVSdlsLGAT-MICITSTYECLTLPL---------LSSI-----RPHSP 483 spotted gar
XP_003459163        419 ELAAEKRCIVEHILCTRPLLTSQSAPIRGFLIVSdlaLGAT-MICITSTYECILLPL---------LSSI-----RPPSP 483 Nile til...
A2CEI4              420 ELAAEQRCIVEHILCTRPLANSLPAPVRGFWIVSdlsLGAT-MICITSTYECLLLPL---------LSSI-----RPASP 484 zebrafish
EKC41573            423 NVPEQEDCIVEHLICTKPLPSSPVAPVLGLGLVRglsVEPS-LLTLTWDYELVSLPL---------CPSR-----YRDSA 487 Pacific ...
XP_001949727        394 SPDIQGQSFVEYYICTG-LMNGETKPIKGFAILS---FPTDlLVTLLSNGEVVTQAIpdfhynklsIANMytnedNPASE 469 pea aphid
WGS:AAPP:GF17877-PA 414 EMAASSS--AEYILCTKFESSDRVNPVFGIALLQ---MPAG-VVLLLGSGQVISLKL---------VIDAkl--lVTPSE 476 Drosophi...
NP_001016790        424 ELAAEQKCLVEHILCTKPLRCRLPSPIQGFWIISdlsLGTS-MICITCDFECIARPL---------LTTI-----RPPSP 488 tropical...
EEN52725            501 PTLSSLPSQPVTS-PLRKLHS--KPFDQHIRDILRRD--ASNPILk-SIPKGSQPSDQECFQLLTRATQVFRDEYIKKQY 574 Florida ...
2_pfamImport        471 PLLSEKGDNTITApPPVPTQE--PSFTEHIKSILKRD--VSQPIIr-SGSSRESTSERECLQVVTRATQVLRDEYMLKQK 545
Q3SZ56              505 PLLCTREDVEVAEsPLRILAEtpDSFEKHIRSILQRS--VANPAFlkSSEKDMAPPPEECLQLISRATQVFREQYILKQD 582 cattle
XP_006640886        484 PLLCSRPGAGLGSsPLRGLAE--DSFEQHIRNILARS--STNPLLlrAGEKDSAPPPSECLQLLSRATQVFREEYILKQD 559 spotted gar
XP_003459163        484 PLLCSHPGLGSASsPLRGLAE--DSFEQHIRNILARS--STNPLVlkAGDKDTSPPPPECLELLSRATQVFREEYILKQD 559 Nile til...
A2CEI4              485 PLLCSHPGAGSDSsPLRGLAE--DSFEQHIRNILARS--STNPLMlrSGDKDSSPPPSECLQLLSRATQVFREEYILKLG 560 zebrafish
EKC41573            488 GPLHTDEDPTTIEsPLRRLSR--EPFDLYIKKILQRN--VTNPKL--KFDKKTEISQQECFQLLTRATQVFREEYLQKQE 561 Pacific ...
XP_001949727        470 DQVDSSENVDKDD------------FSSFISALLQKEngTRNTIL-----KLGPDVPKEIVVQMVLQTINMRRGTLNNHK 532 pea aphid
WGS:AAPP:GF17877-PA 477 S---KAINVDSDL------PDcgTTFVDTIKSLLQRS--VNQPIL---ADKLVAPSATESYELLNQAIEVLREQYLKRHD 542 Drosophi...
NP_001016790        489 PLLCFKIDKSSTEiIPHVLEDvkGPFEEHIRGILRRN--SANPLLlnSSSKDSSPPPEECLQLLSRATQVFREEYLLKQD 566 tropical...
EEN52725            575 QAREEVEKRVDLLKEQKAQQQTDLHTLREDRKSLTETAEKLAEKYEEANEKQQEYLRRVENVLKNLQARLPVLSDAEVSM 654 Florida ...
2_pfamImport        546 LARNAITKRVNLLSDLKLNQLDELHRLGDMKEVLTDNAEKIANDYEDCKERQESLMIRLEDVLKRTRDRDPVLSKSEVAM 625
Q3SZ56              583 LAKEEIQRRVKLLCDQKKKQLEDLNYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKVLHSFHSQLPVLSDSERDM 662 cattle
XP_006640886        560 LAREEMERRVKLLGEQKKKQLEDLALCREERKSLREMAERLAEKYEDARYRQEAIMNRMKQVLGSLRCQLPVLSDSEKDM 639 spotted gar
XP_003459163        560 MAREEMQRRVKLLTGQKNKQLEELSLCREERKSLREAAERLADKYEDAKYRQETIMNRVKKVLCSLQSQLPILSNSEKEM 639 Nile til...
A2CEI4              561 LAHEEMQRRVKLLSGQKNKQLEDLALCREDRKSLTEAAERLADKYEDAKYRQEAIMNRVKRVLGSLRSQLPVLSDSEKDM 640 zebrafish
EKC41573            562 HAQQEIQKRTRMLRSLRAQQEGDVRSLEVSRNHVRNMAESLATKYSDCQDKQEEILQRIEEVMRRLQEKMPMMSEAERGM 641 Pacific ...
XP_001949727        533 IVSEEIERRVRMLAKAKERQLQEMQRLEEARKKLQDDVENKAEKLDEISNKQEKLTQRASSMLLRLVSAAPDSISIKKK- 611 pea aphid
WGS:AAPP:GF17877-PA 543 LVRAAFARHINQIQLKRDQQLQEIQDLEQERELISERAHKLAERFEEISDNQEVLVRKCHALMQKANVALPSNVVAERDF 622 Drosophi...
NP_001016790        567 LAKEEIQRRVKLLIVQKEKQLEDLQYCKEERKSLTEMAERLAEKFEEAKEKQEDLINRLKRILRCFNTQLPVLSESERDM 646 tropical...
EEN52725            655 KKELESLQEKLKHLKNSTQQVKTKWDYQKRQVT----QQARQSSSPALSQSQSKHMKELLKQEGDKIGELVKQVNSLKLH 730 Florida ...
2_pfamImport        626 NKELRAMKEKLWQLDNRIKQLKIKQEYQADKLT----SDHRKTGSVSSSSLHREKLKQILLEEGEKIHELIKKLNNLNAQ 701
Q3SZ56              663 KKELQLIPDQLRHLGNAIKQVTMKKDYQQRKMEk--vLSP-QKPTITLSAYQRKCIQSILKEEGEHIREMVKQINDIRNH 739 cattle
XP_006640886        640 RKELQTISDQLRHLGNGIKQVTMKMDYQKKQMEk--gMTT-PRTSLALNANQRKCVQSVLKEQSEHIADMMKQIKDIKNH 716 spotted gar
XP_003459163        640 KKELQTINDQLKHLDNCIRQVNMKMEYQKTQVDk--dMPG-TRARVSLNAPQKKVVQDVLKEQGQQIGDMMKQIKDIKNH 716 Nile til...
A2CEI4              641 RKELQTINDQLRHLDNGIKQVNMKKDYQKKQMNa--gASP-AHSSLTLNAHQRKCLQGVLKEQGEHIAGMMKQIKDIKNH 717 zebrafish
EKC41573            642 KRELETMEEQLEIYKRSLDQLKIKQDYQRRQISq--tPNR-QLSSPSLKSSQLKQLREVLQQEGDDLGNLLKRVNSLKle 718 Pacific ...
XP_001949727        612 RELLEGYKTKMDLMNKRIEEAREKWNIVQSESAaavyKQIYGSRSLKLTLEQELVIKGNLSEMGSTILDLEKKVRDLRTV 691 pea aphid
WGS:AAPP:GF17877-PA 623 IQEVNRLNSVTQILATGLQTAKNTINKQRYHIAk--sQDDLKRNAYELPEKQHRTITEILTQLASEIDRQITDVKRINKI 700 Drosophi...
NP_001016790        647 KKELHATQEQLQQLGNAINQVNRKMSYQEKQMEk--gKSP-RKSSLTLSDYQKKNIKVVLKEHGENIQEMVKQINNVRNH 723 tropical...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap