Conserved Protein Domain Family
BORCS8

?
pfam10167: BORCS8 
BLOC-1-related complex sub-unit 8
This is the N-terminal 80 residues of a family of proteins conserved from plants to humans. It contains a characteristic NEP sequence motif. Family members include BORCS8 (BLOC-1-related complex sub-unit 8) also known as MEF2BNB. It constitutes sub-unit 8 of the BORC complex (BLOC-one-related complex). BORC is a multisubunit complex that regulates the positioning of lysosomes at the cell periphery, and consequently affects cell migration. BORC associates with the lysosomal membrane, where it functions to recruit the small GTPase Arl8. This initiates a series of interactions that promote the microtubule-guided transport of lysosomes toward the cell periphery.
Statistics
?
PSSM-Id: 401975
View PSSM: pfam10167
Aligned: 25 rows
Threshold Bit Score: 115.035
Threshold Setting Gi: 75100010
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFJ21435       7 EALQQAHDLAADMVKQMANEPSVGLYFVQQHVHKAVPAIVSLKDQVGDCAHDSGLSTEDAKDALATVRNFKGVGPPViER 86  Selaginella moe...
XP_003105087  16 SRARIISDRISESIRLLDNEPSLALYRLQEHTVRSLPGIVNRRIQLTQQSATLSGAQFDLENCLSTTTNMQNASSSF-EN 94  Caenorhabditis ...
XP_005999487   8 IKVKRVTDKFTESMYVLANEPSLALYRLQEHVRRSLPELVQHKTDMQSWEEQSQGAIYTVEYACSAVKGMTNSSVHF-KS 86  coelacanth
Q4S3C1         8 LKVRRVADKFTESMYFLANEPSVALYRLQEHVRRSLPELVQHKTDMQSWEEQSQGAIYTVEYACSAVKSMTNSSIYF-KN 86  spotted green p...
XP_003213319   8 LKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYACSAIKSMTDSSVYF-KS 86  turkey
Q9D6Y4         8 LKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKSLVDSSVYF-RS 86  house mouse
A7SGF0        16 YRLKKVSEKFIESIHLMVNEPSVGLYRIQEHVRRSLPQLVDKKMELRSCQNQINGVCYDLDYSIKTVQSMQHIP-HF-TI 93  starlet sea ane...
EGG16011      31 ESILKSNKKISDYIHHLANEPSVGMYHVQEHIRKAVPKNVTLKKEVKNLTSHIEDISYNVDDSIKAIQSINEIT-TF-NH 108 Cavenderia fasc...
EFA83266      28 DSIFKANKKISDYVHQIANEPSVGMYHVQEHIRKTIPKNVAIKKEIRELDTHIEELMYNVDDSSATIQSIAEIQ-TF-NH 105 Heterostelium a...
O80964         8 DGFAEINESLAEMIKYIANEPSVGLYYIQQHIRNAAPNVINLNNNVLEKSRETGLHTEDLEDSIAMVKSMKDCGSPIaDE 87  thale cress
EFJ21435      87 MMKRLNSSIQALQPSRSKESSySVSEMA 114 Selaginella moellendorffii
XP_003105087  95 CIEMLRNCMFYKQQLDFDSTRkATSSDS 122 Caenorhabditis remanei
XP_005999487  87 IEGLLRQAICIKDRMSSSQSRsTIDTQA 114 coelacanth
Q4S3C1        87 IDSLLRQTISMKEQISNSQGRsPHVSAP 114 spotted green pufferfish
XP_003213319  87 IDSLLKHAIAMKDQLNAAQGRsTVapqa 114 turkey
Q9D6Y4        87 VEGLLKQAISIRDHMNTSAQGhSQEKLS 114 house mouse
A7SGF0        94 IQECLRSAIASKKNLDAAKLErRSKKVD 121 starlet sea anemone
EGG16011     109 IHELLVSSIDRASKLVNNKSLaYVNSQQ 136 Cavenderia fasciculata
EFA83266     106 IHDLLLSSIDKVSKLVNNKSLqFINSSH 133 Heterostelium album PN500
O80964        88 MIGDIKNSLAIMSSKQPRRGViLNSTSP 115 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap