Conserved Protein Domain Family
Tmemb_40

?
pfam10160: Tmemb_40 
Predicted membrane protein
This is a region of 280 amino acids from a group of proteins conserved from plants to humans. It is predicted to be a membrane protein but its function is otherwise unknown.
Statistics
?
PSSM-Id: 401968
View PSSM: pfam10160
Aligned: 17 rows
Threshold Bit Score: 257.655
Threshold Setting Gi: 74963384
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q18936        72 GFRVRYWDAVILVPNILFLLFLILKCGSVIRKLRTGNSPVLRAFTLLVYVSTLVNIIRCAYSMTLsmTDGLEQT-VDQTL 150 Caenorhabditis ...
KRG96904      35 KCHGFWHNATLIIPSFLFVFYLALQARHSLLKVSLARSYIIISYNLCLCLVTLLNLAWCFLQAWE--CTSGREL-TWNLL 111 soybean
XP_003556491  29 ECHGFLHNAGLIIASFLFLLYLALQAKKSFLKLSHGRSYIIISYYASLWLVSILNLLWCFSQAWE--CSPGKEF-AWNLL 105 soybean
XP_006347837  42 ECHGLWHNVLMIVPSVLFVLYLASQAKRSFSKVSNGRSHVVAVLYAILWLVSIFNLAWCSLQAWE--CAPGKQF-MWSVI 118 potato
F4K2U8        31 KCHGFLHNTVLVAASLFFVAYLAYEAKKSLSKLSNRRSYIMIAYYGCLWLVSLLNLAWCCLQGWE--CTPGKEV-VWNLL 107 thale cress
EFJ08036      59 GQHGVLYYLVMLLPVLAFTVFLIARARKCVKKLLQSQSPIMATYYACLWIISILNILWCVLEMK-----HSSST-SWNLI 132 Selaginella moe...
XP_002499712  97 aSREVWFDVLVALPTVLFVMFLASHLRASVEKLRATRNHVMATYYTNLWFVCILNLLRCGVQMWQ--ASPLNHVrLWNAL 174 Micromonas commoda
EDO39501      35 GSWIRICDIVLLAPNAMFMVFLFYSLGLAHAKLVGTRCPIVKTIYTLLLLYGIHYTL------------------NSQAF 96  starlet sea ane...
XP_783628     72 ksnIRVWDVMLLVPNAIFLLFLLLRSKVAVAKLRQTNRPIFVTFYIMAFVATIVSVIRAAVSMIVdaTTVTGDI-TDTIL 150 purple sea urchin
Q4V8X0        53 TSRVRYWDVMLLIPNVAFLVFLMWKLPSARAKIRLTSSPIFVAFYILVFVVAAVGITRAIVSMTVs-TSSAATL-IDKVL 130 zebrafish
Q18936       151 WIIIKFFYLTAEFCALTFGLlfghLDNGKSILIALLGTLLVSIPHTAVQVIIEMKIidnswlpltyfdIQSDGGFLF--- 227 Caenorhabditis ...
KRG96904     112 SLFTTSGMLFLEVSLLAFLL----QGNNAGGLEAMKRTFGISTLVVGLDILLKAIY------------LFVFGIPLFvds 175 soybean
XP_003556491 106 SLFTTSGMLFLEVSLLAFLL----QGNSTTGLEALTRTFGISGIIVGFDILLKAIY------------LFAFGIPIFins 169 soybean
XP_006347837 119 SLFTTSGMLFLEVSLIAFLL----QGNHASGREALTQTFLISAIVVGLDISLKGIY------------LFGFGIQLFdvs 182 potato
F4K2U8       108 TLFTTSGMLFLEVSLVAFLF----QGNYASGAEALTRTFLISGFIVALDLLLKAIF------------LFGFGVPLFidn 171 thale cress
EFJ08036     133 SLLTRFGMVLLEVSVVVFLS----QGYLTSTWDALVRTLTFSGFVAAVDALIKAIL------------IFRFGIPLFvag 196 Selaginella moe...
XP_002499712 175 WLATRFGMDSLEVSAVVYLYlahgHSRAVGAAAALRETVVIAMGVAGIDLLAKSVL------------IFGFGVQVFvee 242 Micromonas commoda
EDO39501      97 WLLLRCLLLSVELSVIIFGVcaanLDSRSSVRRVLLFTSASAVLFTSAQAVLEFTQdgihspyggtynLFQHGGMIF--- 173 starlet sea ane...
XP_783628    151 WLAVRFALLSIELCVVIFGIgfshLDSRSSITRILLITCVISLCYSVVQGCLEVKYpdhhykapnehdIFTHGGMIF--- 227 purple sea urchin
Q4V8X0       131 WEITRFFLLAIELSVIILGLafghLESKSSIKRVLAITAVLSLAYSITQGTLEIRFpdkhls-akdfnIYGHGGRHF--- 206 zebrafish
Q18936       228 ---------------WVFSSAVLALVYFFIMCLPLVCCQKYtkLPSKGSFLIYCMMMVVLNVLQSMGAALILFKSS-DGL 291 Caenorhabditis ...
KRG96904     176 ndht----hhgkwnlWVVHKLLLTAVYGFIMFMYHSGWKET--LPAKIAFYKYVAIMFIFNAIATLACGLAGTHAA-FAF 248 soybean
XP_003556491 170 dypt----phvkwnlWVAHKLLLTLVYGFILFMYHSRWRER--LPARPAYYKYVTIMLILNAIALFACGITGNGTA-FGF 242 soybean
XP_006347837 183 nng-------sqwalWVIHKLLLTGVYGLIFFMYRSTWRER--LPARPAFQNYISIMFCVNATALLACALAAHGTG-FGI 252 potato
F4K2U8       172 neng----ktfkwglWIIHKLLLTGVYGMVFLMYNSRWREK--LPARPAFYNYIIIMFALYSLYLVASAFTANNAH-FGF 244 thale cress
EFJ08036     197 sdag----dwskwsfWFLHSLVFSGVYFFILVLPFTRWRDH--LPARPAFYNYVLVLFVLNMSRSLGSFILGCGSE-FGY 269 Selaginella moe...
XP_002499712 243 pglhsrayfwakwgyWGARAFIAALVYGVLTALPRTRYRDW--MPARPSFYRYTGVLFVMYAVETVCALCVGGGVSrWAY 320 Micromonas commoda
EDO39501     174 ---------------WFASSMLFFVMYFSLLILPCISFGRRlrLPGKPSFYRYCGFLALINILQSIGSALIYYHIT-FGT 237 starlet sea ane...
XP_783628    228 ---------------WCVTSSIFCLAYIIVFLLPYTPVKNRiqLPAKRSFYCYVASLTLLNFSQAIGSGLVYGDVQ-PAI 291 purple sea urchin
Q4V8X0       207 ---------------WLASSCFFFLVYSLIVILPKTPIRERisLPSKRSFYVYSGILALLNLVQGLGSALLCADII-EGL 270 zebrafish
Q18936       292 CFVGVSTYVYFVLYPPIIYFTFLRKKLKTPpnntsglfmyrkhkdeqgsgD--LPDSYYP 349 Caenorhabditis elegans
KRG96904     249 WLYRVTVVFYHAFYLPFLYTTFLADFFQEE--------------------NfhLENVYYS 288 soybean
XP_003556491 243 WLYHFTVVCYHAAYLPLLYITFLADFFQEE--------------------DlhLENVYYS 282 soybean
XP_006347837 253 WLYNITVICYHAMYLPLLYITFLADFLQED--------------------DlhLENVYYS 292 potato
F4K2U8       245 WLYGIMSVCYHALYLPLLYITFLADFFQEE--------------------DlnLENVYYS 284 thale cress
EFJ08036     270 CIYSFTNYAYYAFYPPLLYLTFLADYFKEE--------------------AfqLEDVYYS 309 Selaginella moellendorffii
XP_002499712 321 CVFGLCNYAYYACYPPVLYLTFLADYFRED--------------------EyeVESRYYS 360 Micromonas commoda
EDO39501     238 CILDVTVFTYFALFAPLVYVTFLAEFMSSPsqtvlql----------krrrdyLPNLHTg 287 starlet sea anemone
XP_783628    292 CLVDITSFLYFTCFAPLIYITFLHNFFQASkqllllsyasqpdenddethhlpysvsrdd 351 purple sea urchin
Q4V8X0       271 CCVDVTTFLYFSVFAPLIYVTFLKGFFGSEpkilfsyks---qidepedsDvhLPHTSSS 327 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap