Conserved Protein Domain Family
BORCS6

?
pfam10157: BORCS6 
BLOC-1-related complex sub-unit 6
This is a family of conserved proteins found from nematodes to humans. Family members include BORCS6 (BLOC-1-related complex sub-unit 6) also known as Lyspersin (lysosome-dispersing protein) or C17orf59. It constitutes sub-unit 6 of the BORC complex (BLOC-one-related complex). BORC is a multisubunit complex that regulates the positioning of lysosomes at the cell periphery, and consequently affects cell migration. BORC associates with the lysosomal membrane, where it functions to recruit the small GTPase Arl8. This initiates a series of interactions that promote the microtubule-guided transport of lysosomes toward the cell periphery.
Statistics
?
PSSM-Id: 401966
View PSSM: pfam10157
Aligned: 15 rows
Threshold Bit Score: 161.371
Threshold Setting Gi: 1005972381
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKC38994     214 KGELFEFVADDLQEKIRQSSPLPKTESsGlssrtsSCRSIASISSGNSSamga--sltsEMSRSPSsqfphspidIPPID 291 Pacific oyster
XP_002024674 129 SGEMRHFVAHNLEEKLREGAGAGTPL---------DYSSEHTTPSTSMGpgggegiltrRFLQSRN---------IPEVD 190 Drosophila pers...
XP_015793620 126 DDGMITFVAHDLENKLRLSSVMSS-----------PCISSSSDEPSSSN--------------------------SATLD 168 two-spotted spi...
EFX89576     139 EGDMIHFIAKNLETKIRLSS---------------PDISESS------------------QLLAAQselakqhqsVATPE 185 common water flea
XP_001122052 122 DGDMVLFVAEDLENKIKLSSPVTKKGE-Tp----sFPGSRSSTPCLY------------RQALTPQ---------VPLLD 175 honey bee
EEC01744     177 EGDMVNFVAEDLQEKIKLSSPVTKLAEgLp----sFPTSRSSTPSLY------------KQLLAPQ---------LALVD 231 black-legged tick
XP_026691412  60 kGGQVSFVSNDLLGQINSAASSQPSETaSs----lMELSPSSSTSDRMFkrk---------------------snMPVVD 114 vase tunicate
2_pfamImport   1 -GGQMSFVSKDFANHIYSASSHGSDLDsL------TELSPTSSLTDGMFnkr---------------------snMPIID 52 
Q1LVE2       285 DGDLTHFITKNLEQKIKMSSR--------------PSLDTDSDCSGPITrg------rgSLRRPAD---------IPPID 335 zebrafish
Q66H43       215 HGDLTHFVANNLQLKIRLSGAPSPVPPaSg----rPCLTPAPTPT------------------------------IPPID 260 Norway rat
EKC38994     292 PMAVMELEMAAKRVADNVDLLMGNLRSNLHKMSAITVGCLDAYKKSVDTTCDSVDSSIKSMYALMAKCEELSKSMQPVYQ 371 Pacific oyster
XP_002024674 191 GNVLSDIELEAQYLATSVDNLLENLGNLLHSISSITADNVEVHKNAVNKLTDTLDANIKCQYQLLAKTEEITKSMKPTER 270 Drosophila pers...
XP_015793620 169 LNFLSKLESQAQQISKNLDQVMKYIYNYTCQVSSLTLNSVKNFETCLTATCDSVDSNIKLMYQLMAKYEELGSVMSPIEK 248 two-spotted spi...
EFX89576     186 STFLAQLERDARCIAASVDGLTEHLVSSLHTISAVTAQSLTVYKDSVCKTCDAMDGNIKSMYQLMAKCEELSKAMTPIYK 265 common water flea
XP_001122052 176 HNVLNELEMEARKVATSVDALTENLAAILHSASALTVGCLETYRDAVCKTCDAVDHNIKSMYQLMAKCEELSKSMGPVYK 255 honey bee
EEC01744     232 PTVLADLEGEARTVAASVDSLLQSLSANMHSISSMTVDCIRLYERGMCKTCDVADSNIKAMYQLMAKHEEVSNSMKPLYS 311 black-legged tick
XP_026691412 115 GNVIDDLEKDCEKLSQSVDLVIQQMASKLDKISALSVGNIQTCSDTVNQMGLTVDQSVRTMYSLIAHAEELDDAMEPAYL 194 vase tunicate
2_pfamImport  53 GSIINELETECDKLTHSVDAVIHQMSAKLNKITALSVGNIQTCSDVITEMGTAVDESVKSMYSLVAHAEELDDAMEPAYR 132
Q1LVE2       336 PSVLVDLHKHTQDVAQSVELMLRSLNGTIQNMTALSVGYIQTYRDSVDSLGESVDMSIKGMYTLMARCEELDRSMQPIHT 415 zebrafish
Q66H43       261 PDVLRDLERLSRELGGRVDRLLCGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQG 340 Norway rat
EKC38994     372 LGNQIKEIKRLLDRFESQ 389 Pacific oyster
XP_002024674 271 LGQRIREIKRLVDTLDSI 288 Drosophila persimilis
XP_015793620 249 LADEIKEVKRLLALFERe 266 two-spotted spider mite
EFX89576     266 LSEQVKEIKKLLDIMENl 283 common water flea
XP_001122052 256 LAEKIKEMKRMLELFESA 273 honey bee
EEC01744     312 LANQVKNIKKLLDHFENA 329 black-legged tick
XP_026691412 195 IAAKIHKIKDVLSALESQ 212 vase tunicate
2_pfamImport 133 IAAKINKIKDVLSALESH 150
Q1LVE2       416 LAAQIRDIKRTLDALETI 433 zebrafish
Q66H43       341 LARQVRDIRRTLEVLEAL 358 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap