Conserved Protein Domain Family
DUF2362

?
pfam10154: DUF2362 
Uncharacterized conserved protein (DUF2362)
This is a family of proteins conserved from nematodes to humans. The function is not known.
Statistics
?
PSSM-Id: 401963
View PSSM: pfam10154
Aligned: 15 rows
Threshold Bit Score: 346.265
Threshold Setting Gi: 74854649
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAI25951      41 SDLHGRIMLLHRIPC--FVETD--LKNRLGSFIESETLADYDRDAEAALQKLTSGEVDI-NKLTNLWAKAYSETTLEHAR 115 zebrafish
2_pfamImport   1 KELVARVMNYHDIPC--FVETG--LNNKLKNFVDNERQNLHDDQAALLLQKIRDDPTLI-DHVADVVAEKYKNTWQEYAP 75 
XP_011445727  35 SDLVGRLVNAHNLPC--YVEED--LKNKLEKFMTEETNKLFDENSQKALQRLKNGDINI-DDVVTKWHNAFSEEVKRYAK 109 Pacific oyster
XP_002118317  15 NELAHRLITAHNLPC--YLLGK--LQASLKEFVSSTLCQLQVDKAEQSIHHLKQFGPDViKDISDHWCKCLQDEVAHWSD 90  Trichoplax adha...
EEB17831      41 REFTYRILYNNKIPH--YLFDD--VYSQLEKFVETETLRYYDEVAEEKLKEFKNDDFDV-DSVVKYWEKLFKNETVEYCE 115 human body louse
XP_008200044  30 GELVHVLILKNNLPI--YVEKD--LAENLSQFVNDWSIKHNNEHTASLIDDARNDKTNI-DEITKEWEKLMREEMAEYGE 104 red flour beetle
Q7QB80        38 AELSHQIVAVRMDPImkFLKADreLLPTLQAFVERENQSFYDERDELLLDKFRHGSPDV-DGLALDTEKLYREEILEFAD 116 Anopheles gambi...
Q16FU9        38 DELAHRIVTQRMDPImtFLQADkdLKVALRSFIEKENQDFYDERDEALLEKLRTGHVDV-DALALELERSYKDEILEYAD 116 yellow fever mo...
XP_008183385  43 DELSHRIINGFNLPL--NVIEE--LSSELQKFVEKCTIDFYDCQTVDAIESIRNESIEV-EDIVKYWEKAFQEETFSFTD 117 pea aphid
EEC12362      42 keivFRLMQEEQLPC--YVEDD--LTTSLSDFIAHETEQFFDQTSSTAIEKFQRDG-DV-EALTARWTRDFREASLAEEE 115 black-legged tick
AAI25951     116 PEEa---------SWDEDFASVYHELIHS-PASETLLNLEHNYFVSVSELISERDMELKKLQE----------RQAVEMN 175 zebrafish
2_pfamImport  76 PIS----------TQPNNFPLSYHYLIHS-PAMQILMQLEKKYHSAVAKLLSDKEQSLTKMCE----------RHRGEMS 134
XP_011445727 110 PESv---------TEQQVFSEVYHSLIHS-PALDTLLNLEHTYALTIEDLIQQRDKDLEYLDD----------RQREEME 169 Pacific oyster
XP_002118317  91 HSNkrnavqsiqlDNGQSVAQVYHALIHS-PAMEAILQLEYTYASVVKEIVKQRNTELEQFEI----------QHQQQLE 159 Trichoplax adha...
EEB17831     116 PTGt---------TDEELFSMVYHKLVHS-GALESILKKEQMYGATATSLAHKRKKEIKELSEkqvfiyvkinKQNDEMT 185 human body louse
XP_008200044 105 RRCa---------SDEELFATAYHKMVHS-PALETMLQLEHMYSKTVRAKTEEKNRCIQNLSM----------KQTEEMN 164 red flour beetle
Q7QB80       117 RVGp---------TDEEIFAQSYHQLVHS-SLLPEILAKEREYARTIASLTTQMTQQITTMNT----------LHQEEIE 176 Anopheles gambi...
Q16FU9       117 RVGp---------SDEEIFAQSYHQLVHS-SVLSEILAKERDYAKTITNLTAQMTQQINTMNS----------LHQEEIE 176 yellow fever mo...
XP_008183385 118 NKGp---------SNDQLFGTAFHKLAHSgPSLDAILHIEYGYAQAVQDIMSRKCRQVTSLTK----------TQTEEMN 178 pea aphid
EEC12362     116 -------------TPDSRFPHMYHTLIHS-PALDTVLNLEHTYAVAVGDMVRERDETLGRLQK----------RQTSEME 171 black-legged tick
AAI25951     176 KVMQEL-------GKTLCDQDVNTVAAQHFEAQQV--LESKWASELKQVTGIQKQEYQEWVMKLHRDLQ----------- 235 zebrafish
2_pfamImport 135 RACDHV-------GFEYTTEDVSILATKQLADTDR--MQKHWEDNYRRLTEEQKQEYCDLVIRLAEEMK----------- 194
XP_011445727 170 DAMKNA-------GTKYTDAQVNQLAQRHIDNSQL--ISGKWSSELSNLRDTQKREFREWVLKVHEDTQ----------- 229 Pacific oyster
XP_002118317 160 IAIQ---------SGIASDRKVSRLAAQHMEELQF--KNAKWNSTLSDLMENQKREFYAWMVRVYNSMVenngvptertl 228 Trichoplax adha...
EEB17831     186 VAMQDLhsmtiesEIRVSEKDINDLAAKHFEEQCL--TSGRLNSEVEALHQSQRKEYRAWLMAMYENEAl---------- 253 human body louse
XP_008200044 165 HAVDRL-------EQDMTESKINELVARHYEAHSL--LKVKLTSELDTIKEAQRREYREWLMQMLEQNQ----------- 224 red flour beetle
Q7QB80       177 SKIKLL-------DISITPENINHMLAKQYGMQNM--IRKQCESELESTRGHQKHEYRNWVTQHVDESFlgq------se 241 Anopheles gambi...
Q16FU9       177 SKMKLL-------DISVTSENINHILAKQYNMQNM--IRKQCESELESTRGHQKYEYRDWITTHIDASFlae------sd 241 yellow fever mo...
XP_008183385 179 YAMDGL-------NKYTTEDDINALALKHFDDQTL--LQGKWNSRLDTLKQEQRTGYREWVMKTVEEMQgvdglyspign 249 pea aphid
EEC12362     172 RCVQQV-------GLTLTDRDINDIAARHFEETQAsrLMDQWDKRIGSLKQTQRKEFWEWVRTVHEDYT----------- 233 black-legged tick
AAI25951     236 NPNNS-TINEEIKVQPGQLGEAGEAADRLFEEQRQ----------------LEESFTIHLGAQLKTMHNLRLVRSDVLDF 298 zebrafish
2_pfamImport 195 QSDNKlNENGPVHNEVQRLLDHNRGRSLVSTRDPSedvesessvtvscgilMEESFTINLGAQLKTMHNIRLVVADMLYF 274
XP_011445727 230 SPSKStSYLNRVRALSSSLPEAEE--NERGPNTIR----------------MEESFTIHLGAQMKTTHNLRLLCTDILDL 291 Pacific oyster
XP_002118317 229 S-----MPHSIVATLSRAAPDSHLNHESNNHVDNR----------------MEESFTIYLGTQKKTMHNIRLMIGHPLDL 287 Trichoplax adha...
EEB17831     254 SPTLHlTSTSPKVLDNSSLDSGISSQPEPWPH-------------------FEESFTIHLGSQLKQMHNVRILSANALDF 314 human body louse
XP_008200044 225 -----------------ATSSLPTPNSPLTPHTPQpaiyssecarsidtpiLEESFTIHLGSQLKQMHNIRILSANVMEL 287 red flour beetle
Q7QB80       242 SPTQIgNRWSMISTQAPS---------------------------------MEESFTIHLGSQLKHMHNIRILSTRVADL 288 Anopheles gambi...
Q16FU9       242 SPTQIgNRWSMISTQGPS---------------------------------MEESFTIHLGSQLKHMHNIRILSTKISDL 288 yellow fever mo...
XP_008183385 250 SPINIvTNGFTISNM--SLYD------------------------------MEESFTIHLGSQMKSTHNIRIMSADTLNL 297 pea aphid
EEC12362     234 TSKGDrGFGARMRAASRSLAGHEVDNWTPPPPRPS------------------ESFTIHLGSQLKVMHNLRLLSANVLDL 295 black-legged tick
AAI25951     299 CKH--RRHSSsg----vKLRRLQTALSLYSTSLCGLVLLVD-NRVNSYSGIKRDFATVSQECTDFHFPRVDEQLEIVQQV 371 zebrafish
2_pfamImport 275 CRY--SDDGEm------EAQRFQTAMSLYSNSLSAIVLITD-KNLNECSGIEKEFRTVCESSTEFHFETLQDQTTKVKEH 345
XP_011445727 292 CRH--KTHTVggm-vipQPQRLQTAMSLYSNDLCALIMMVD-NRLNSYTGLKRDFSKVCEQSTDFHFPDLEQQFAIIEQE 367 Pacific oyster
XP_002118317 288 CRS--AYTGSigsgigpPPQRIQTALSLYSSTLNGLILLVD-DKPNCYTGIKNEFAMICEESSEFHFLSHPEQLHHIRRS 364 Trichoplax adha...
EEB17831     315 CKIklPPEGVsh----vEPRRSETALSLYSSSLSGIVLLVDvGSFDGFAGLAKDFVDVCQQTTEFHFNNIESQLEAIKIQ 390 human body louse
XP_008200044 288 CAV--EDNDQss---epKPQLLQTALALYSSDLSGLVLMTD-NKIG--SRLTQDFQEICQRTTEFHFPHIDDQLDKISNT 359 red flour beetle
Q7QB80       289 CSP--LYGDA-------SFGGPNVALGLYSSSLCGIVVLTPsGTITPDREIRRN----ANMSTEFHFEQIDRQIEKIQED 355 Anopheles gambi...
Q16FU9       289 CSP--LYSDT-------SFGGPNVALGLYSSSLCGIVVLTPsGSVSPDTEIRRN----ANMSTEFHFDQVDHQIEKIQDD 355 yellow fever mo...
XP_008183385 298 LSLtlEENGTvv----hHPQRLQTVLELYSQDLKGLVLFIDtNNLDFYSGLAKEFFDICDGSTEFHFNSLQDQLEIIKSD 373 pea aphid
EEC12362     296 CRHttyg------mgvpAPQRLQMAMSLHSNSLSGLVLLVD-NRINSYVGIKREFAAICHESTELHFADIDDQLETVRAK 368 black-legged tick
AAI25951     372 VLYARAQRNSKqreqpempRNGGNEDKNKILDRNSSN-------ILQGEFYITRHSNLSEVHIVFHLCVDD----NVRS- 439 zebrafish
2_pfamImport 346 ALEASERRNRS--------LSSEETIEYKQNIDEMDGtg----tLNEGDFYITKHSNLSQVHLVFHLVAEEnqlrTKASl 413
XP_011445727 368 LALANEHRQQH--------KHSEDADKVSLKSSSSTSseeknknLRSGDFYLTKHSNLSEVHVVFHLVADD----SIKQ- 434 Pacific oyster
XP_002118317 365 IQKSQSTRAKRq------dSEDNDIDSLEIFWDEDDDsv----vLALGDFYSTHHSNLSDIHVVYHLVVND----DVKS- 429 Trichoplax adha...
EEB17831     391 VKDAVQWRSEK-----------AKNSSGYQNSKMSSGgk----sLQAGDLYITKHSNLSQVHVVFHLLVDD----SVKN- 450 human body louse
XP_008200044 360 AQLYLKSQKEN--------------------SNRNINse----lLQAGDFYITRHSNLAQVHVIFHMVSDD----SLRG- 410 red flour beetle
Q7QB80       356 LRNLQHGHAVE--------AGGAQSLAAAAGRRPDRTvv----tVKPGDAFITRHSNLSHSHVIFHLISDE----TFQSp 419 Anopheles gambi...
Q16FU9       356 LRKLRDSPPEE--------QDFGNGGGEPRSSR-----------LKPGDVFITRHSNLSHSHVIFHLISDE----TFQSp 412 yellow fever mo...
XP_008183385 374 LKVAVENRKCK--------GPVSNFLSPELQARRNKSk-----lLQCGDVYITKHSNLASVHLVFHMVIDD----SLKS- 435 pea aphid
EEC12362     369 AREVAEIRTAAs-------LSGSDGSSSQSSRRSSFSgq----dHSPGDFYVTRHSNLSEAHVVFHVVGDE----SLRG- 432 black-legged tick
AAI25951     440 GNITARDPAIMGLRNILKVCCTHDITTITIPLLLVHDMSEEMTIPWCLKRAELVFKCVKGFMMEMASWDGGISRTVQFLV 519 zebrafish
2_pfamImport 414 TTVTSRHSVILGLRHILKVASSHDIRHITIPLLLSHELTEEITFQWCVKRAELVMKCIKGFMMEMATWDGGISRTIQFVI 493
XP_011445727 435 SDISSRHPVILSIRNIIKLCFRYDINTITIPLLLFNEMTEEMTIPWCQKRVELMFKCVKGFMMEMAAYGGYKSRTIQFLV 514 Pacific oyster
XP_002118317 430 DRLPNRHPILTGLRNALNTAASNDVTTITIPLLLVNEMTEEMTISWCVKRAELIFKCVKGFMMENEMWSNNQACIVQFLI 509 Trichoplax adha...
EEB17831     451 SDVNSRHPVILGLRNILKTAASYDITTITLPLLLTNEMSEGMTVAWCSKRAELVFKCVKGFMIEAAGVGGADIINLQFLV 530 human body louse
XP_008200044 411 SDINSRHPVVLGLRNILKTACSNDITSLTIPLLLQYEMTEEMTISWCEKRAELVFKCVKGFMIEMASWGGSELKNLQFML 490 red flour beetle
Q7QB80       420 SEINSRHPVILGLRNILKIASRHDITTLTIPALLRHEMSEDMTVSWCIRRAELVFKCAKGFMIESASWGGAELNTLQLLL 499 Anopheles gambi...
Q16FU9       413 SEINSRHPVILGLRNILKISSRHDVTTLSIPALLRHHMSEDMTVSWCIRRAELVFKCAKGFMIESASWGGAELNTLQLLL 492 yellow fever mo...
XP_008183385 436 GDINSRHPVILGLRNILKTACSYDITMITIPLFLTHEMTEDMTVPWCQKRAELVLKCVKGFMIESVSLGGSELKTIQFLV 515 pea aphid
EEC12362     433 ADVGSRHPVILGLRNVLRVAHERDVCGVTLPLLLSHELYEEMTIPWCLRRAELVFKCIKGFMIEMASLVGEETRTVQFLV 512 black-legged tick
AAI25951     520 PQSISEEMFYQLSNMLPQIFRVSSTL 545 zebrafish
2_pfamImport 494 PPGVSEEAFDRLRYTLPEVFRTTSTR 519
XP_011445727 515 PPGISEDVFSGISSMLTNIFRLSNPL 540 Pacific oyster
XP_002118317 510 PKGISEEMFNTFTGMLPGIFRMAAAL 535 Trichoplax adhaerens
EEB17831     531 PSGISAEVFSTLATMLPTIFRVCNPL 556 human body louse
XP_008200044 491 PQGISSRVFQSLTEMLPRIFKVSNPK 516 red flour beetle
Q7QB80       500 PHDISEELFRTLADMVPHVFRVANPK 525 Anopheles gambiae str. PEST
Q16FU9       493 PYDISEELFRTLADMVPHVFRVANPK 518 yellow fever mosquito
XP_008183385 516 PKGISEEVFGILATMVPTIFRVSTPL 541 pea aphid
EEC12362     513 PQGISEDLFASLSAMLSSIFRVSNPL 538 black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap