Conserved Protein Domain Family
SMP_2

?
pfam10144: SMP_2 
Bacterial virulence factor haemolysin
Members of this family of bacterial proteins are membrane proteins that effect the expression of haemolysin under anaerobic conditions.
Statistics
?
PSSM-Id: 401953
View PSSM: pfam10144
Aligned: 20 rows
Threshold Bit Score: 165.146
Threshold Setting Gi: 81544476
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8ZIQ1             1 MARAKLKFRLHRTAIVLICLALLVLL-MQGASYFSLSHQLARSEQVEELAQTLAKQVAFSLSPIMDSGDDnidSQKVDAI 79  Yersinia pe...
WP_015698750       1 MARAKLKFRLHRAAIVLISLALLVIL-MQGASYFSLGHQLARSTQVEQLAQTLARQVAFSLAPLMDSDNDgadIAQISTI 79  Rahnella aq...
WP_024912065       1 MAKAKLKFRLHRTAIILICLALLVML-MQGASYFSLSHQMARSEQVEELAQTLTKQVAFSLAPLLDDNSDv-dNQRISSI 78  Chania mult...
Q9L8J3             3 lTKEKFIKLSMISSIIILCIAIVSVI-LFGVQQFKIGSQLASVNQVSNLSHLLIRQQANLLSMLLVNNAS---TEQLTES 78  Pasteurella...
USMARC:WQG_18610   3 inrektIKFSIIGLVFVFCFAIVALI-LNGINQFKAGSQLATVNQVSHLSHLLVRQQANLFSLILMKNAR---HEEINEA 78  Bibersteini...
ACL32711           3 isREQLIKSSIIAVIMAICLMIVWII-LTGINHFKVGSQLAGINQVTNLSHLLVRQQAKLFSLMLVKNAK---NDELVEA 78  Glaesserell...
Q7VNW6             3 LTREKVIKTTLLAGIIVVCVMIVSVI-LNGVNQFKLGSQLASVNQVSNLSHLLVRQQAKLFSLMLVKNVN---NDELIEA 78  [Haemophilu...
WP_012073831       3 LVKEKILKSALLTVIIALCAAVMALI-LFGVKQFQTGSQLAGVNQVANLSHLLVRQQTNLFSMLLQNNAN---GATLTES 78  Actinobacil...
Q65RP6             3 IIKEKLAKSLMFVVIIALCITVMSII-LFGINQFKIGSQLASVNQVSNLSHLLVRQQANLFSMLLVNNAG---NEQLTDN 78  [Mannheimia...
Q9KPM1            22 mdgslfsFRVVVRVATVLAVAVMFFItIQNSVVISKGNERIQANQLETLTKVLITQAAMSAGSMIADQDQ----ERLLAL 97  Vibrio chol...
Q8ZIQ1            80 LQQLTQSSRILDASVYQIDGTLVASAGENVKVRDRLALDGKRPGSY--FNHQIVEMIAGNSGPSGFLRMTLDTHVLATES 157 Yersinia pe...
WP_015698750      80 LSQLTDGSRILDASVYQSDGSLVAHAGEQVPVRDRLSLDGKRAGSY--FNHQIVVPIEDKNGPSGFLRITLDTHVLATES 157 Rahnella aq...
WP_024912065      79 LQQLTHHSRILDASVYQLDGTLVAHSGEQISVRDRLSLDGKRAGSY--FNHQMVESIQGKDGPIGFIRVTLDTHVLATES 156 Chania mult...
Q9L8J3            79 LDAFAKEEFVLDASIYSNRGELLAHTSHFQNLRLTLGLNSPTQPDEe-NTQQIVEPIYSLNGIEGFLRVTFDSKYGKTTQ 157 Pasteurella...
USMARC:WQG_18610  79 LEHFAKEDFVIDASLYSTNGTLIAQSSNALSFKVSELAQINT-------TQQIVEPIFIQQELSGFLRVTFNAEYGQTTR 151 Bibersteini...
ACL32711          79 LDVFAKEAFVIDANLYSPSGNLVAHSSNAIEFNPRVNDKIQQEPA---LTQQIVEPIFAQDDLIGFLRVTFDSQYGQTTQ 155 Glaesserell...
Q7VNW6            79 LDAFAKEEFVIDANLYAANGSLIAQSHNALQFKKLLLEEGSQP-----LTQQIVEPILTQQNLIGFLRVTFDSQYGQTTQ 153 [Haemophilu...
WP_012073831      79 LDKLINDDMVLDASLYANNGELLAQSTASLNLRRRLGLGADESE----RVQQIVEPIYAENSVIGFLRVSFDGRYGQATQ 154 Actinobacil...
Q65RP6            79 LENLTKDKFVLDASIYGKNGELLAQTRNTLDLREQLGLNEESSKHHvvNRQQIVEPIYSPNGIEGFLRVTFDSKYGQTTQ 158 [Mannheimia...
Q9KPM1            98 TNQLATDRLVFDASIYDSEGVLLAASESALSVREVLGLDTPLHTASi-GRQQLVEPVVHDGSLIGFVRITFETG------ 170 Vibrio chol...
Q8ZIQ1           158 KQVDN 162 Yersinia pestis
WP_015698750     158 KQVDN 162 Rahnella aquatilis
WP_024912065     157 KQVDN 161 Chania multitudinisentens
Q9L8J3           158 SKIDh 162 Pasteurella multocida subsp. multocida str. Pm70
USMARC:WQG_18610 152 NKINa 156 Bibersteinia trehalosi USDA-ARS-USMARC-192
ACL32711         156 HKVNe 160 Glaesserella parasuis SH0165
Q7VNW6           154 SKIEQ 158 [Haemophilus] ducreyi
WP_012073831     155 SKVSQ 159 Actinobacillus succinogenes
Q65RP6           159 NKINQ 163 [Mannheimia] succiniciproducens MBEL55E
Q9KPM1           171 -KVTA 174 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap