Conserved Protein Domain Family
GPDPase_memb

?
pfam10110: GPDPase_memb 
Membrane domain of glycerophosphoryl diester phosphodiesterase
Members of this family comprise the membrane domain of the prokaryotic enzyme glycerophosphoryl diester phosphodiesterase.
Statistics
?
PSSM-Id: 401925
View PSSM: pfam10110
Aligned: 22 rows
Threshold Bit Score: 185.898
Threshold Setting Gi: 122973841
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAL82739       19 IRKNFTYFKKSFFINIGFESIYKVLTSFIFLPFITMVLNYFMHLRGMKMMANNQILSFVGSIP-GILTILILGILSFLFI 97  Clostridium bo...
Q03U33          7 WRESTRHFFQHWGSYVTLVFITNLAISYVAVPAFTWLTAALMKWQHVPYVSYTNIGSIALRHPlAIIGLLLILLAIITLI 86  Lactobacillus ...
Q03I21          4 TLKTYRYIFKHIFSYIWLFIASTVAVYGILIPIFTLIGSVMLRLARVRYISNTNLIEIISQHPvLDLGLILLILAVIVAI 83  Pediococcus pe...
Q8CYV1          9 KKLGLKQIYLNLDKILFLFFLIFMIVEYLWVPFNSWLASFLLDQTGYLFISYNNVLAILTHSPlISLAFLALIVINLLVA 88  Streptococcus ...
bgi:05SSU0193   4 IQREFQKIYYNLDKILLLFFTLFTFMEFVWIPLNSWISEGLLAMTGHAYLSPTNLLSVFAENLlVTGLFILLFFVNIAIA 83  Streptococcus ...
Q8Y9B6          4 LKDSFKVLYQFKTDYLKVTLLLTILQAFVIGPFIYYFFFFILRVIGVPGITDANLGEVFS-SPvAIIMLLILALLILLFV 82  Listeria monoc...
Q9A0C2          4 LSDLISLMTKIRLSWVIKAGIFQLLFVTIANIVLSEFFYFILDVTGQYHLDKDNVVTFLK-NPiALALLGAYLFLLAAFI 82  Streptococcus ...
Q898L8         10 IINIFKDIKYGFFRLIKYQIGTKILLSIIILPIFNFLINILIHKSDRFPLVNGEIIKFGL-SKeGAITLFMLFILAYIII 88  Clostridium te...
Q186M2         17 LSKLVFIIKYNFSTLILFELFHKGLALFFIWPSIRYIFDILIKSLHIVYLNMDNFIKVLT-NPmSIVLIILSVIILAFYA 95  Clostridioides...
WP_012064220    5 LTSSLKDFRKTYKRYIAFELIYKLMASFIFVPLIAYVFNRILISMGSGPLLNNEVFRIAL-NYkGVTGLIIIAMLSVVLI 83  Alkaliphilus m...
CAL82739       98 FIEYAGLIVISQETYFd---KKISAKAA-FFTAMKSI-----RGIMKVGSIPIIIYVLFIIPFVasSMGLSSSLLPKIEI 168 Clostridium bo...
Q03U33         87 YWQFAYLLLGIMNIRNg---RPQTSRAV-LGDVFRSL-----VGASPSTFLFFIGYFVVIIPFG--SELFSTPLLNKAKI 155 Lactobacillus ...
Q03I21         84 YWQVTFLFLGTMQINYg---KKLTIDSL-LRLSIQRV-----RKTFFRSVWFLLIYCILILPFG--GLGFSTPLLNKIRI 152 Pediococcus pe...
Q8CYV1         89 YFQIGLLFIGARHLLYnekrRLIEYIRKvFHESFGFM-----KKLTCAKALFIFFYIAMLFPFI--RKMLKIYYLNKIVI 161 Streptococcus ...
bgi:05SSU0193  84 YLELALLFTGVWQLLDekvkHLTDYLRDvRDSMVAII-----RHSSLPKVLFLLFYSVILLPFL--RRVLNIYYFNKIVV 156 Streptococcus ...
Q8Y9B6         83 YYELGFFIMMAIYQLRg---ESYTFFKI-IQRLNVKA-----KYFLSYQAIYFLLYFFLLLPIA--GLSLPITITENLYL 151 Listeria monoc...
Q9A0C2         83 HLEFFALYRIIAD-------QEISFYL--FRKQFSYYlrglwKTFSGYQLLLFLLYILLTIPVL--HIGLSSVITQKLYL 151 Streptococcus ...
Q898L8         89 LSEIGGLIIISNQLYLr--kEESSYADI-FKYCFKRF-----YKIFGVGSIFILIQFFLFVPLL--DIGINSSFTSFVKI 158 Clostridium te...
Q186M2         96 FFEFTSVIICLNKSIKy---EKIGLFEL-FKISFENS-----IKLLYPKNILLFIFVILIIPLV--NTVLISGFIGKIQI 164 Clostridioides...
WP_012064220   84 FIEFGVLVVISQKKYFy---KDISISDS-LITTIKTL-----PKIFGFGTLHLMLFLLFLIPLI--DLPLSSTLIESYEL 152 Alkaliphilus m...
CAL82739      169 PTFIMDvVYKTPKWI-SL-YAIVFFILFYFLIRWIFSLHVVVLEGK-DFSSALKRSSQLVKGSFLKIwTTMFLWNLSIFA 245 Clostridium bo...
Q03U33        156 PAFIVTyLMANPLW--AVfLGIFYVAAAYIGIRLIAVLPLMMLDGY-HSHEAIRLSWQRTRRHFWAY-FSKILVTLAIVT 231 Lactobacillus ...
Q03I21        153 PSFLVDyFLTENRPL-LLvMILLYVVTFYLGIRLFLVLPLIILGKR-NAHTAVKQSWQITKINFKPI-VLRLVLLFATTI 229 Pediococcus pe...
Q8CYV1        162 PEFIQA-YLEDRYWMwWLsILLLSLIFLYVSVRLMFALPKIVYDQL-TVREAVMFSLEKTKKRVTFY-AWNLFYILLKAH 238 Streptococcus ...
bgi:05SSU0193 157 PQFIVD-YLSNTVWL-GIlILIFLLLFFWLAARFMYALPNIYFEHR-GVKESIAYSWEKTRGRKQIGsLFRLIWLVTFPV 233 Streptococcus ...
Q8Y9B6        152 PHFITDeLMKTTTGT-WL-YVIAIAIIFYISARLVFALPYFIEDKSlKISGAIRKSWKYPQKHLFFMlLKWVLIIVAIGF 229 Listeria monoc...
Q9A0C2        152 PEFIVGeLSKITSTK-YLlYGSL-ILVFYLNLRLVYFLPLIAINHR-TVAQAWRESWQKTKKKHVLLwMKLFAINGLTIV 228 Streptococcus ...
Q898L8        159 PDFIEDyIYSDNILI--VfQYILMMIMIYFALRWIFSLHIIILENK-SATKALKESGQLVKRNLKEFiKRYVTFSILNGI 235 Clostridium te...
Q186M2        165 PEYILDyIKSDIILN-II-YMIFLLIIYISVIRWIFSIHEITLNTE-NFKRARKESVNLIKGKIIRTiIYSLILSLVVAI 241 Clostridioides...
WP_012064220  153 PMFLREkIWGSSLFS-VL-YVTGLLWAVYLFMRWIFALHFIVLEGK-STKDAITSSLELTKNNRIKIlLKLILLNVAFFT 229 Alkaliphilus m...
CAL82739      246 IVAVVVILVGIGMV----LLNEVlKGNVK--LFVTILSFVttmggiLVMIATLFISPLTIMLITQLYYRQVKMKDGVEPI 319 Clostridium bo...
Q03U33        232 VMVTLIYGLIYLGQl---GFD---RTGFG--LAAATFNLF------LMEIITEFIVCYSTVIFMMVVLSSHDSQQQTPLS 297 Lactobacillus ...
Q03I21        230 VVIIAGQLLVLGEQt---LFDRMtPTGVA--FLAASVNLI------LIEFFMFLSSIAAGAGSLMIMTEYLAGDQRFTAH 298 Pediococcus pe...
Q8CYV1        239 LLFYLPLIPLLLAQt---LVDDI-TQRES--LILGILNFV------VIKNLYYMALTYFLVKFVSFLTG----------- 295 Streptococcus ...
bgi:05SSU0193 234 LLFTGVGGLFYLVQl---LAEHF-VPSAS--YWLAVVCYA------LLKLAYYGVVALFMMGFVSLLTG----------- 290 Streptococcus ...
Q8Y9B6        230 LVSIIATIIMLPLL----LVEKI-TPGIA--VVIAGITLT------ILQVIGFFAAGIFQGIIAQLLVKNAFAIKEQPAL 296 Listeria monoc...
Q9A0C2        229 VLSLAISMILI-------FVDMFnPKGNN--IIVQLGALT------FTWELIFFTTIFFKLCSAMILKEAIEPQKQYDE- 292 Streptococcus ...
Q898L8        236 LYFIILVLWMSLVAn---ISKNIsYGSYSgkFILGGIVFFhqmgavLL---SFIYIPIQVQFTTRMYYKFAYINENKTIP 309 Clostridium te...
Q186M2        242 IGYAIYHSGIIFIGiwtkYCTDMeFLKNV--FINRCIAFEey--frLILSIFIFILDIGFISATYYQYKGVNISKNN--- 314 Clostridioides...
WP_012064220  230 LVVSIFSIVGMIS-----TPARVsIRGYS--LENYFITFSs----lATYIFTLILTPINVIFLTRLYYQSHVMQGLELKD 298 Alkaliphilus m...
CAL82739      320 Pmittstpsk--inwqnlfnrHKKKLIAVSVLGIMIFTWLSYVYF 362 Clostridium botulinum A str. ATCC 3502
Q03U33        298 L--------------------FSFREPARTKLRTRLLIISGLTLI 322 Lactobacillus brevis ATCC 367
Q03I21        299 Thrlsdq---------lqelsYNVGNQRWIRIIAGLLVIGGIGFn 334 Pediococcus pentosaceus ATCC 25745
Q8CYV1        296 -----------------------KELDMLPRREKDHIVRWGVMTC 317 Streptococcus pneumoniae R6
bgi:05SSU0193 291 -----------------------KQLPIYRRKRLRHHLRLAILLV 312 Streptococcus suis 05ZYH33
Q8Y9B6        297 Vtrs--------------qfpHKKRFIIVAIIIFIIFSSFNIYTV 327 Listeria monocytogenes
Q9A0C2        293 ---------------------PRRSNKAYVVIFIVVTVGFAYQSL 316 Streptococcus pyogenes serotype M1
Q898L8        310 Slnlkikek----dslldkifKNKKMFIEIFTIIFLFSTLLIGMI 350 Clostridium tetani
Q186M2        315 ---------------------IKKEKKSISKIVFNLVLILLISYI 338 Clostridioides difficile 630
WP_012064220  299 NlkihhnkrlqklenlvgglfRRRRNFVFLILVINLIVMLYLNFA 343 Alkaliphilus metalliredigens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap