6PBT


Conserved Protein Domain Family
DUF2338

?
pfam10100: DUF2338 
Click on image for an interactive view with Cn3D
Uncharacterized protein conserved in bacteria (DUF2338)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401915
View PSSM: pfam10100
Aligned: 9 rows
Threshold Bit Score: 666.363
Threshold Setting Gi: 488140165
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6PBT_A                26 NVLLVGLGAVAIQVALDLRRHGAGRLGALNHP--GRRSQRIAEALARGAcLQLEG--QGQHRWLSGNAALDVFHQDPAEL 101 Pseudom...
Q5HKH2                 3 KILMVGSGPVAIQLARLCNLHGEHMVDMVSRVhaSTKSKRVFDAYHRDG-FFSVMtqNDAHQCFSGKFTVRHFFKDVKDI 81  Staphyl...
WP_002211373           6 PTLILGAGPAAIQLAVDISATGDARLGLYNRP--STKGERLKQYLALTPtLYLQGtgKAQATQKESSVTIDCYIDQLAQA 83  Yersini...
WP_013348444           6 NILIAGTGPVAVQSAVLLGT-LPGELGIAGRG--SQRANAFFDALDATAgTAQSTvqNPAHGALAGTVRFAHRYRGYQQV 82  Glutami...
WP_015802676           6 RVLVAGTGPTTAQLAVLLGTGRGSAVGIAGRR--SARSAAFFAGLERAGrTVRVDvqNEQHRAAAGEHPVAEVFQGYEAV 83  Actinos...
WP_015891119           6 RILLLGTGPASIQMAVMFKKHWKCCVGVVGRE--SVRSTSFFTALQQSSqQIRADiqNEKHQKMEGECQIDHVFHGYGSV 83  Breviba...
zhongguo:PM3016_2180   7 RVLILGTGPASVQLAVTLKNKWNCCIGIAGRE--SVRSEPFFTALDESGrRVRADiqNEKHQAMQGECIVDHVFQGYGTI 84  Paeniba...
WP_015735098           6 RVLILGTGPAALQLAVILKKGYRCHLGIAGRE--SVRSADFFESLAASGqRVRVSiqNEKHHALEGECRLDGVFRGIETI 83  Paeniba...
Q9KB58                 6 RVLLLGTGPTSIQLAVTLKHHLNCYIGIAGRE--SVRSESFFEAVNQSDqLIHVSvqNEMHRAMEGTCFIDQVIKKYETI 83  Bacillu...
6PBT_A               102 RDDWQTLVLCVPADSYLDVVRGLPWERLGGVRTLLLVSAFIGANLLVRSALPAGC--QATVLSLSSYYAATKVIDET--- 176 Pseudom...
Q5HKH2                82 TQYYDVVILACTADAYRPILQQLSKSTLKRIKQIILVSPTLGSHMLVKQILSDVHc-EGEVISFSTYLGDTRIFDKA--- 157 Staphyl...
WP_002211373          84 VGDWQRLILAVPADHYYAVLQQIPWAALPQLKSVILLSSSMGSGLMVQNLLNAAGkrDVEVISLSSYYADTKYIRAEtqd 163 Yersini...
WP_013348444          83 AGRWDTLVLAVTADAYLAVLRELAPEVLVSLRRVVLLSPTLGSAALVREFAGGQAa-DLEIISFSSYLGDTRPLEGT--- 158 Glutami...
WP_015802676          84 TGRWGALVLAVTADAYTPVLDRIDPEVLRGLGCVVLVSPTFGSHALVRGRLRGLGa-DAEVISLSSYLGDTRWSDGA--- 159 Actinos...
WP_015891119          84 TGEWDTVILSVTTDAYTEVLQQINDQVLQQIKCMILVSPTLGSNSLLRHYLNRIGs-NAEIISFSTYLGDTRWFHDQ--- 159 Breviba...
zhongguo:PM3016_2180  85 TGEWDTLILAVTTDAYVAVLKQIHGELLKRVRCMLLLSPTFGSNRLVRHYMNGIQs-SAEIISFSTYSCATRWAGPR--- 160 Paeniba...
WP_015735098          84 EGQWDTLILAVTTDAYLEVMRQIDQDVLRKVKSLVLISPTFGSNRLVSGFIWELNp-GAEIISFSTYIGDTRWVDDR--- 159 Paeniba...
Q9KB58                84 EDEWDTLIFSVTTDAYKEVLKQIDDELLKRVKCTVLISPTFGSNGLISHYMNKLNp-DAEVISFSTYLGDTRWMHDR--- 159 Bacillu...
6PBT_A               177 ------------------QPLRALTKAVKRRVYLGSSRPDCPARET--WRRVLAGSGVEVVPLATPEAAEGRNVTTYVHS 236 Pseudom...
Q5HKH2               158 ------------------QPHCVLTTRVKSKLFVGSTHSQSITLYK--LKSLFDYLNIELTTMDTPLHAEIHNSSLYVHP 217 Staphyl...
WP_002211373         164 isantqdinagtqdigaiQPYRAYTKAFKQRIYLANQWGNAGSAEMswLTAVLARHHIDTLPCSNLLAAERFSITNYVHP 243 Yersini...
WP_013348444         159 ------------------GGALVLSAGVKARIYAGSTHGHTPALQA--LCAIHAEAGTQVQLMDQPLEAEARNMSLYVHP 218 Glutami...
WP_015802676         160 ------------------PSPHVLTAGVKKRLYLGSDRGGTPNLEL--LRELHRGLGVDPVAVSGPLEAETRNISLYVHP 219 Actinos...
WP_015891119         160 ------------------PSNRVITTGVKKKLYIGSTRAPSPSIKR--LCELFKQVGIHLEVMDSPIEAETRNISLYVHP 219 Breviba...
zhongguo:PM3016_2180 161 ------------------PSHQVITTAVKKKVFIGSTHGRSPAIES--LCGLYEKLGTTLEVMDSPMEAESRNISLYVHP 220 Paeniba...
WP_015735098         160 ------------------VSNHVITTGVKKKVYIGSTRGRSDLVDR--LCGLYKQSDIEVEFMRTPLEAEARNISLYVHP 219 Paeniba...
Q9KB58               160 ------------------PSNHVLTTAIKKKIYIGSNHVSSKNVHK--LCEVFKQIGINVEVMESPFEAETRNISLYVHP 219 Bacillu...
6PBT_A               237 PFFLGEFALARILSEQGPPGFMYKLYPEGPITPGAIGAMRRLWCELSELLRRMGAEPLNLLRFLNDDNYPVHETMLPRAS 316 Pseudom...
Q5HKH2               218 PLFMNQFSLKAVFEGTKVPVYVYKLFPEGPITMTLIHEMRLMWQEMMMILKKLKVPSVNLLKFMVKENYPIRDETMREVD 297 Staphyl...
WP_002211373         244 PLALADTTLQALFYPEQRSQYLYKTQPEGPVCPAVIADLAGLADDYKRLLNRLGVEEINLLRFLNDDNYPVPASMVSRRW 323 Yersini...
WP_013348444         219 ALFFNEVALRAVFAPAPPIQYVYKLYPEGPVTPALIHALAQTWRELTAITTALGGKGVNLLAFMLQDGYPLHPQSISPAQ 298 Glutami...
WP_015802676         220 ALFMNELTLNAVFFETTPVKYVYKLIPEGPVSPALVNDIVSQWREITAVVAELGVDGVNLLRFMVDDSYPVRPESISRRD 299 Actinos...
WP_015891119         220 PLFMNAFSLRVIFGEEPIKKYVYKMFPEGPITQYLIRDMLAQWKEITKVVEKLNIKGLNLLKFMTDDNYPVRLESLSRDD 299 Breviba...
zhongguo:PM3016_2180 221 PLFMNEISLGAVFGEDVTQKYVYKMFPEGPITQYLIRDMLAAWKEMMSILEQLHFEGINLLKFMTDDNYPVRLESLSRHD 300 Paeniba...
WP_015735098         220 ALFMNDFSLNAIFDESGTRKYVYKLFPEGPITQELIRNMLSQWKEMMNILSRLGMRSINLLKFMTDDNYPVRNESLSRQD 299 Paeniba...
Q9KB58               220 PLFMNDFSLNAIFGSFSAKKYVYKMYPEGPITQYLIRNMLAHWKEIMDIIGKINIKKINLLQFMTDDNYPVRIESLSRHD 299 Bacillu...
6PBT_A               317 IDGFAEAGAERQEYLLFVRYAALLVDPFSPADEQGRHFDFSAVPFRRVSRDEDGLWRLPRVPLEDYRKLALIVALAAHFD 396 Pseudom...
Q5HKH2               298 IESFENLSAIHQEYLLYVRYTAILIDPFSNPDDQGAYFDFSAVPYKHVDTDEQGVIHIPRMPSEDYYRTLMIQAIGRALN 377 Staphyl...
WP_002211373         324 IDEFPQLPPLEQQYALFVRYTALLVDPYSTPDEQGRFYDFSAVKVATVYQDANALWHLPRVPLEDVHKLRTLLLLAGALD 403 Yersini...
WP_013348444         299 AASFEQLPPIEQEYLLYVRYASLLIDPFSQPDDQGRYFDFSAIAFRPVFINELGQWDVPRMPKEDYYRTKIIAGLARKLA 378 Glutami...
WP_015802676         300 VERFEELPPVHQDYLVYVRYASLLVDPFSEPDADGRYFDFSAIPIRRVFRDAEGRWEVPRMPKEDYYRTKVVQGVARSLG 379 Actinos...
WP_015891119         300 IENFVHYETIHQEYLLFIRYTSLLIDPFSEPDSDGRYFDFSAVPIRKIFINREGYWDIPRMPKEDYYRIKIIQGIARYID 379 Breviba...
zhongguo:PM3016_2180 301 IEHFTELETIHQEYLLYIRYTSLLIDPFSEPDQEGRYFDFSAVPIRSIFVDREGYWDIPRMPKEDYYRIKIIQGIARHLN 380 Paeniba...
WP_015735098         300 IDCFEHLESIHQEYLLYIRYASLLIDPFSQPDPEGKYFDFSAVPIWSLFINLEGCLDIPRMPKEDYYRIKIIQGIAGFLK 379 Paeniba...
Q9KB58               300 IENFNHFTTIHQEYLLYIRYTSLLIDPFSEPDEHGHYFDFSAVPFRKIFINKEGHLDIPRMPKEDYYRIKIIQGIANYLS 379 Bacillu...
6PBT_A               397 LAMPQARSLLASYENAVSRFIDCQGASQCHPSLYPIDSRPAADAIYRQW 445 Pseudomonas aeruginosa PAO1
Q5HKH2               378 VATPMIDTLLLRYETTVKQYCDTHLHQQLSKQFELHHFKQDLALVTNYL 426 Staphylococcus epidermidis RP62A
WP_002211373         404 VVMPTAQRLLQRFQQALKAFIDRVGEEHCHPSLLGDDCDRQAAIIEQQW 452 Yersinia pseudotuberculosis complex
WP_013348444         379 VPCPMIDSLLAAYETALEQAAHELAGQRRAPAFAVQDFAADLDMISAgi 427 Glutamicibacter arilaitensis
WP_015802676         380 VPCPTIDGLLARYEDALTRAAGLRAGEPLTDAFTVRDFHEDLDVIRAEL 428 Actinosynnema
WP_015891119         380 SSCPTIDTFIETYESKISEAAQTRKGEQLSDAFVVQSFAEDLKMICSEI 428 Brevibacillus brevis
zhongguo:PM3016_2180 381 VSCPTIDKFISAYEGKLEAVAQARKGELLSDAFVIQDFAEDVKMICHEM 429 Paenibacillus mucilaginosus 3016
WP_015735098         380 VECPTIDRFISAYEGKIVSVALAHKDRSLSGAFAVQSFGEELAMICKDL 428 Paenibacillus sp. Y412MC10
Q9KB58               380 VPCPTIDQFITTYEKAIKQIAQSHKDKKLSQAFVVQSFDEDLQMICSEI 428 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap