Conserved Protein Domain Family
DUF2322

?
pfam10084: DUF2322 
Uncharacterized protein conserved in bacteria (DUF2322)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401902
View PSSM: pfam10084
Aligned: 26 rows
Threshold Bit Score: 143.538
Threshold Setting Gi: 123612322
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011795409    3 FSERLKQLPSVAHLSALHLLAPGGETVATLENKPGQAGSLAVYHALGQLYGGrITPAAATLGLEWYAEHTADAQAHPGKH 82  Acidovorax cit...
WP_012637225    4 FQDNLKQLPSIDHIARLELYGDGYEPEASIENKPGSQGSLAVYYKVSVDHGG-LTPNAARDALGLFAEHVQDAHDHPGKH 82  Thioalkalivibr...
WP_015257325    1 ---mgsDLPDVSQIDRLELFADDYTPVAVIENRDGQRLSLQIYYHAARTFGG-IGPKAANSALLRYGEHVADARRNPGKH 76  Thioalkalivibr...
WP_012983611    1 ---mpKNLPDVSNLERLELFGEDYNPSATIENVDGQTLSLQIYYQLALDYGG-IGPKAANSGLLMYGSHADDARAHPGKH 76  unclassified T...
WP_015829355    4 FSEILSTLASADHIQSIALYTPDQQPAGLIENKPGSQGSLKVYQHLLKKHGA-ITPAAAQEGLELYAEHTADAKAFPGKH 82  Methylovorus g...
jgi:M301_0425   4 FSDVLQTLDDASHVQRIELFNSDGSAAGAIENKPGSQGSVKVYYHLFRMYGE-ISLDAAVEGLSLFAEHTADAENCPGKH 82  Methylotenera ...
Q1H4D4          4 FSEILAGLESSDHIQKIELFDAKGDPAGIIENKPGSQGSVKVYHHLYKKYGI-ISAAAAREGLEIYAEHAADAQANPGKH 82  Methylobacillu...
Q2G318         11 FKDNLVLLPSIDGLARIDIVAGDGRVAASIENQPGKQGSLAVYRYLKLCFGE-LNAQAAGHGLAVFGEHTPDAIARPGAH 89  Novosphingobiu...
Q3SLL1          3 FADTLNTLPEFTG-EAVVLSDAAGAELGRIANAPGTAGSFRVYAYLAQRYGA-IDAEAAAEGLAIFAEHTEDAARHPGKH 80  Thiobacillus d...
Q7NRZ3          4 FQDLLQTLPPTDGIDAIVLLSPEGEAMHRLENRPGTAGSVRVYHALVKRHGR-IDRNAAREGLELFAEHTAAARAHPGSH 82  Chromobacteriu...
WP_011795409   83 PNIDRLVEWAKGDVAYGVRL 102 Acidovorax citrulli
WP_012637225   83 PNIDRLFKVIDEDLYYSVKA 102 Thioalkalivibrio sulfidiphilus
WP_015257325   77 PNIDRLFDIIINDRFLSVHA 96  Thioalkalivibrio nitratireducens
WP_012983611   77 PNIDRLFEILDKGYYLSVKA 96  unclassified Thioalkalivibrio
WP_015829355   83 PNIDRLLDVVSSQHTLTAKV 102 Methylovorus glucosotrophus
jgi:M301_0425  83 PNVDRLLNLLEDEQPLTVKV 102 Methylotenera versatilis 301
Q1H4D4         83 PNIDRLFRVIENAGPLSVRI 102 Methylobacillus flagellatus KT
Q2G318         90 PNIDRLLEIANGGEALSIVV 109 Novosphingobium aromaticivorans DSM 12444
Q3SLL1         81 PNVDRLVDILKTGVPLAARV 100 Thiobacillus denitrificans ATCC 25259
Q7NRZ3         83 PNIDRLLAIAEQGAPGLRAR 102 Chromobacterium violaceum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap