Conserved Protein Domain Family
DUF2312

?
pfam10073: DUF2312 
Uncharacterized protein conserved in bacteria (DUF2312)
Members of this family of hypothetical bacterial proteins have no known function. Structural modelling suggests this domain may bind nucleic acids.
Statistics
?
PSSM-Id: 401892
View PSSM: pfam10073
Aligned: 64 rows
Threshold Bit Score: 69.126
Threshold Setting Gi: 6226326
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012567313              18 AGDRLRSFIERIERLEEEKKGIQDDIKDIYAEAKGTGFDTKVMRQIIRLRKMEKDDRQELDALLELYMAALG 89  Rhodospiril...
WP_013067696              24 AADELRQFIEQYEQLDAEKKDITAQQKDIMAEARGRGYDTKVIRKIIALRKRDKNDVAEEEAILDLYKTALG 95  Rhodobacter...
PRJNA212980:JCM7686_2264  56 AADELRQFVEQFEQLDAEKKDLTEQQKELMAEAKARGYDTKVMRKVIALRKRDKDDVAEEEAILEMYKAALG 127 Paracoccus ...
Q3IW70                    58 AADELRQFIERYEQLEAEKKEIGGQQKELMAEAKGRGYAPKILRMIVALRKRTPDDIAEEETLLELYKAALG 129 Rhodobacter...
Q3J1J7                    11 TADELRQFIERYEQLEAEKKDVTEQQKELMAEAKGRGYDTKVMKKVVALRKRKPDDIAEEETILELYKSALG 82  Rhodobacter...
ADO42359                  23 TSAEIKEIVEEYETLAEERSGVGDRMSEVMARAKARGYDTKILRRIIALRKRHADDLAEEETILEIYKSALG 94  Ketogulonic...
ADO41543                  10 AADEIRSIVERYETLEAEKKYVAEQLKEVMAEAKGRGYDTKVLRKIIALRKRDQNDLAEEEAILDLYKQALG 81  Ketogulonic...
Q165I2                    28 TAGELRQFVERIERLESEKKDIAEQIREVYAETKSRGYDTKCLRQIVNMRKRDKDDIAEEEAVLEMYKEALG 99  Roseobacter...
WP_011749973              10 TADELRQFVERIEHLEQEKRDIAEQIKEVYAEAKGRGYDGAALRQIVALRRKDKDQVAEQEAVLELYKSALG 81  Paracoccus ...
jgi:Hbal_2941             18 TRDKLRQTIEKVERLEIEKKEIAEQIKEVFAEAKAFGFDPKAMKEVIKHRKQDPDKREEEELVLGTYLAALG 89  Hirschia ba...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap