Conserved Protein Domain Family
DUF2301

?
pfam10063: DUF2301 
Uncharacterized integral membrane protein (DUF2301)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401886
View PSSM: pfam10063
Aligned: 50 rows
Threshold Bit Score: 135.359
Threshold Setting Gi: 147848965
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:MICPUN_71530  65 VALRLIHMYVDPIKKFMQALYAAGLAGSIGVAalasqTGDGGSVPAYVVAHPAAVWAVGPMFAALTGVAFKEGMCYGKAE 144 Micromonas ...
EFN56244          78 vATALIHIYVAPMKRLLQALLAAGAAGAAYLAa----AHPDVPLPAYVAAHPDAVWLVGPAFASLTGICFKEGVCYGKPE 153 Chlorella v...
XP_002960900     117 VSLLLIHIYVTPLKRALQVLWTVGVAGSILVAsn-faTPADRGLVEFVVENPAAVWAVGPLFAALTGLVFKEGLCYGKLE 195 Selaginella...
KRG93137          49 LSLLLIHIYVSEIKRALQALWGLGVVGSATTYfc-laQPANKNLIQYVVDNPSAVWLVGPLFAALTGLVFKEGLCYAKLE 127 soybean
EFH69765         121 LSLFLIHIYVTEIKRTLQALWALGFVGSLATYaa-laRPAGDNLVHYVVDHPSAVWFVGPLFAALTGLVFKEGICYGKLE 199 Arabidopsis...
XP_015690805     116 LSLVLIHIYVTPIKRFLQALWVVGALGSVGTYva-aaQPLDESLVRYVLDHPAALWFVGPTFAALTGLVFKEGLCYGKLE 194 malo sina
XP_009401602     156 LSLLLIHIYVTPIKRFLQSLWVLGVIGSVGTYim-laKPLNQSLIEYVISNPVGVWFIGPLFAALTGVVFKEGLCYGKLE 234 wild Malays...
Q00YY6           118 LSLWLIHMYVSEIRSAMRLMWGVGYGASALIA-----GTSGESAPAYVLEHPSSMLAVGWMFAALTGLAFKEGMCYGKPE 192 Ostreococcu...
jgi:OSTLU_44356  119 gALLMVHMYVGEIRAAMRALWSVGFLGSAAIA-----MSAQEPLPVYVWEHPMSVLLVGPMFAALTGLAFKEGMCYGKPE 193 Ostreococcu...
EEH54279         159 VALTLIHMYVDPIKKAMQAMWLAGFIGSVGIAa----THPDVSVPAFVATHPAAVWLVGPMFAALTGVAFKEGMCYGKAE 234 Micromonas ...
jgi:MICPUN_71530 145 CAALFFVVPATLLAHLTGLANEEIEKGLLGTWCVLIAVFAARKYTQEVKDDIGDKSVF 202 Micromonas commoda
EFN56244         154 SLALALLIPCWLLGHLSGLVPQAGEQGLAAATALLLALFAARKYTQPLKDDIGDKSVF 211 Chlorella variabilis
XP_002960900     196 AALLFFVIPSLLLGHLSGAMDDNVKQGLLAAWMGLFAVFAGRKFTQPIKDDIGDKSIF 253 Selaginella moellendorffii
KRG93137         128 AGLLTFVIPILLLGHLTGLMDDGVKLTLLASWMTLFVIFAGRKFTQPIKDDIGDKSVF 185 soybean
EFH69765         200 AGLLTFIIPSVLLGHLSGVMNDEVKLVLLGTWMALFLVFAGRKFTQPIKDDIGDKSVF 257 Arabidopsis lyrata subsp. lyrata
XP_015690805     195 AGILTFVIPGLLLGHLSGLMDDGTKAGLLGVWMVLFTVFAARKFQQPIKDDIGDKSVF 252 malo sina
XP_009401602     235 AGILTFIIPGLLLGHLTGFIDDGAKLSLLGTWMALFMVFAARKFQQPIKDDIGDKSVF 292 wild Malaysian banana
Q00YY6           193 AGALFFGVPLMCLSHLFG-APEEFQSLSATGVGVLLLIFAARKFTQPVADDVGDKSIF 249 Ostreococcus tauri
jgi:OSTLU_44356  194 AALLFFAVPAMCLSHLFG-ASADVCGVEANVVLALLVVLALRKYSQPIKDDIGDKSIF 250 Ostreococcus lucimarinus CCE9901
EEH54279         235 CAALFFVVPATLLGHLTGVGSEGFEKGAIVAWCALIAAFAARKYTQEVKDDIGDKSVF 292 Micromonas pusilla CCMP1545
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap