Conserved Protein Domain Family
BLOC1_2

?
pfam10046: BLOC1_2 
Biogenesis of lysosome-related organelles complex-1 subunit 2
Members of this family of proteins play a role in cellular proliferation, as well as in the biogenesis of specialized organelles of the endosomal-lysosomal system.
Statistics
?
PSSM-Id: 401873
View PSSM: pfam10046
Aligned: 60 rows
Threshold Bit Score: 60.6778
Threshold Setting Gi: 598068671
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002508669  293 ATFLRVADAVRADVDAVSAEFRHLAAMNQSAGARYAAIGRRVGDAHVFADKVRKVQEtGIAPQLARLETIEASVGSLENV 372  Micromonas co...
Q6CEB6          5 KTVKAAENLIDAQTDYTVTWLDSLEVVNRKQTHKYKQLAESTKGLENDREYLEGLNN-ENARYVDQLKQVRGHLDTLEKL 83   Yarrowia lipo...
XP_013936770   32 nsYECMRKILELDTQSTLTNFNVMETLNNSTILRYRELEPYLDSLESETSKIRALDQ-ELAKNKPKLEQLEERTKKLALL 110  Ogataea parap...
XP_002615500   54 RALTQARKLVESDTEVSTIDLNLLGNLNTNQSLNYIKLESQLTSLEKDAEQREALTQ-ELHSLEDELTLIEKSVASLGEL 132  Clavispora lu...
XP_007375164   13 lALNAASKIVESDTNVSTIDLNLLENLNTNQSLNYIKLEKNLDDMETNSNQLKQLKA-EFESHSQELISIENKIAILEEI 91   Spathaspora p...
CCE43639       11 HALTTLSKVIESDTNISTIDLNLLENLNTNQSLNYIKLENNLNDLEANGKHLKLLKE-EFDQHANLLVDIEKKVMRLEEI 89   Candida parap...
Q6BR74         13 NSLNVLSKLVEADTEISTIDLNIIENLNTNQSLNYIKLEQKLNNLEDNANSLEGLNN-EFKSFNTTLLEIENQINKIEII 91   Debaryomyces ...
XP_011123396   36 tVLSSLENLIEADSSAILGDLDLLHKINEAARERYKAMTEAAVGLETDSEYLRGRYA-ELKKYTKQVDDIDERVGDLEKL 114  Arthrobotrys ...
CCX32098       15 DTLASLENLIRLDTESTVGDLDLLVRVNKHAAERYKAMTDAAEGLETDSEHLKAKYA-EVQKYVKQVDELDERVTDLEAI 93   Pyronema omph...
XP_002836154   12 DVLATLENVIRADTEATVGDLDLLNRVNLHATERYKAIADAAVGLETDSEYLGQKYA-EIEKYKQQVDNLDERVGDLEAI 90   Tuber melanos...
XP_002508669  373 AQVLDARCAELERRFA 388  Micromonas commoda
Q6CEB6         84 VGEVDEWSKELEVKVR 99   Yarrowia lipolytica
XP_013936770  111 VEQMDEWSAELEVKSr 126  Ogataea parapolymorpha DL-1
XP_002615500  133 VEELDQWSREVarere 148  Clavispora lusitaniae ATCC 42720
XP_007375164   92 TTELDQWSKQLEHNVE 107  Spathaspora passalidarum NRRL Y-27907
CCE43639       90 VNELNSWSKELEMDLK 105  Candida parapsilosis
Q6BR74         92 TKELDGLSIELSSKVK 107  Debaryomyces hansenii
XP_011123396  115 VKELDEWCSELEVKIK 130  Arthrobotrys oligospora ATCC 24927
CCX32098       94 VRELEEWTGELEIKVR 109  Pyronema omphalodes CBS 100304
XP_002836154   91 VKELEEWTGELEIKVR 106  Tuber melanosporum Mel28
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap