Conserved Protein Domain Family
DUF2280

?
pfam10045: DUF2280 
Uncharacterized conserved protein (DUF2280)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401872
View PSSM: pfam10045
Aligned: 11 rows
Threshold Bit Score: 161.023
Threshold Setting Gi: 122375776
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Slit_1923       1 MAALSDDVKRRIVQDLACFDTPSQVAKAIKAEFGLIVPLQQVEAYQPGKTAAAKLSKRWLTIFEETRKAFLEDTSQVAIS 80  Sideroxyda...
ACR28695            1 MAALPDNIKVFVTQALACFDTPTRAAKSVLEEFGVVVSPQACERYDPTKRAGATLSKKYRDIFESTRAEFIADTSRIGIA 80  Burkholder...
Q13W70              3 fAPLPTTIKRHIVRALACFDTPSEVVRQVREQFNVQITRASAQRYDPTRAAGETLSEELRTLFFDTREHFVEELEKLPLA 82  Paraburkho...
Q6FAD8              1 MATLNKKQKLFIVRSLAVFNTPQETVVLVKEEFNTDVTRQQVETYDPTKRAGKDLSAEFKAEFEATRKDFLAKPETIPIA 80  Acinetobac...
Q4KA65              1 MAVLRSEVKAFIVQALACFDSPSQVVEAVKKEFGVELSRQQCESHDPTKYAGRGLAQKWADLFHECRKRFREETADIPIA 80  Pseudomona...
WP_012132734        1 MAALKGEVKAFIVQSLACFDTPSQVVEAVKKEFGITIPRQQVESHDPTKANGKGLAKKWVEMFNETRERFQTEIAEIPIA 80  Citrobacter
WP_002211724        1 MAALKPDVKAFIIQALACFDTLSMVAEAVQKEFGIKVTHQQVESHDPTKVSGKGLAKKWVELFTITRERFQTEIASIPIA 80  Yersinia p...
Q4FT05              1 MATLNNKVKAFIVQGLATYMTPSEVAQAVKEEFDIVVTRQQVSFYDPSKAAGLTLSKKWADLFKQFRDDFNTDIQAIPIA 80  Psychrobac...
WP_012205073        1 MARLDEAVKRFIVQALACYDTPSQVAEAVKEEFGLVLDRAHVAVYDPTKASGKDLSKKWRDVFFATRDAFKNEITEIPIA 80  Delftia ac...
jgi:Mrad2831_5697   1 --mLSDEVKTFIVQQLACFDPPSVVVKAVKAEFGETVSPQQVESYNPERRAGQNLGEQFRELFRTTRAAFLEDAASIGIS 78  Methylobac...
WP_014199403        1 MAVLKPEVKAFIVQAVACFDPPSTVVESVKTGFGVVVSRQQVEAHDPTKVSGRGLAERWKELFEETRKAFLEDTSAIGIS 80  Azospirill...
jgi:Slit_1923      81 HRAVRLRALNRMAAKAEDKGNMA 103 Sideroxydans lithotrophicus ES-1
ACR28695           81 HRSVRLRKLAAAVDKAEERGNLP 103 Burkholderia glumae BGR1
Q13W70             83 HRATRLRRLESLYDRASESGNLK 105 Paraburkholderia xenovorans LB400
Q6FAD8             81 NLAVRLQRLENQYQKHSKNRVAA 103 Acinetobacter baylyi
Q4KA65             81 NRAFRLRGLARMAEKAESMRNLA 103 Pseudomonas protegens Pf-5
WP_012132734       81 NKAYRLRVLQRMSVTAENMKNLG 103 Citrobacter
WP_002211724       81 NKAYRLRALDRMAAATEKQKNFG 103 Yersinia pestis
Q4FT05             81 NKAYRLNMLDRMARDAEKSKNRP 103 Psychrobacter arcticus
WP_012205073       81 QRSYRLKVLQRIVSKAESMKNMP 103 Delftia acidovorans
jgi:Mrad2831_5697  79 HRVTRLRALQRLAERAETQGNIA 101 Methylobacterium radiotolerans JCM 2831
WP_014199403       81 HKAVRLRALNRMAAKAEGMGNMA 103 Azospirillum brasilense
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap