Conserved Protein Domain Family
DUF2279

?
pfam10043: DUF2279 
Predicted periplasmic lipoprotein (DUF2279)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 370792
View PSSM: pfam10043
Aligned: 7 rows
Threshold Bit Score: 126.774
Threshold Setting Gi: 262079730
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hoch_3197       150 EGWFGPGTYAGGADKLGHFYSNYLFVRGTVGVLEAGGWERKWALPASLALTLSFFTAIEIKDGYHKgFGFSLQDITANLS 229 Haliangi...
EIM63675             70 EGWFANTTKEGGADKLGHLYSSYVISHALSSLYKHWCFEKENAALYGSLSLFAIMGYMEFGDSFSE-YGFSYEDMIANFL 148 Desulfob...
WP_015460136         34 EGWFGKSTTNLGVDKLTHAYNSYLLAELLNARIGRKSGDRSSGALTAAVLASGLMIYSELYDAHKVsSGFSIQDVLFNTG 113 Sphingom...
WP_025292738        129 EGWFGDNTVNLGMDKLAHAWNTYWLTDVIEARIRHKSG-ASNAALPAAAVSMGLMLYSELWDAHKDtSGFSFQDVAMNAA 207 Sphingom...
jgi:Swit_0026       124 EGWFGKDTINLGMDKLTHAWNTYWITDMIEARIRRKTG-ATNAGLTAASLSMGVMLYAELWDAHKKsSGFSFQDIAMNAS 202 Sphingom...
WP_011979782         77 EGWFGKDTKYGGADKMGHMYSTYLWSLEFSSLYEYWGMDTSRSMIYGSLSAWSFQFLMELGDSFSEsQGFSYEDVVANTV 156 Sulfurov...
goetting:HRM2_20410  72 EGWFEEDSKHGGADKLGHFYFSYTFAHLLSAFYENSGYNTRQGALLGSLSSFAMVSWMEIGDSFSS-YGFSHEDCIMNLI 150 Desulfob...
jgi:Hoch_3197       230 GNALAALLLA 239 Haliangium ochraceum DSM 14365
EIM63675            149 GCTAGYLLYK 158 Desulfobacter postgatei 2ac9
WP_015460136        114 GAAFSVLRNT 123 Sphingomonas
WP_025292738        208 GAGFSVLRNS 217 Sphingomonas sanxanigenens
jgi:Swit_0026       203 GAGFSLLRNA 212 Sphingomonas wittichii RW1
WP_011979782        157 G---ALFYYA 163 Sulfurovum sp. NBC37-1
goetting:HRM2_20410 151 GTTTAYFFYT 160 Desulfobacterium autotrophicum HRM2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap