Conserved Protein Domain Family
MRP-S27

?
pfam10037: MRP-S27 
Mitochondrial 28S ribosomal protein S27
Members of this family of small ribosomal proteins possess one of three conserved blocks of sequence found in proteins that stimulate the dissociation of guanine nucleotides from G-proteins, leaving open the possibility that MRP-S27 might be a functional partner of GTP-binding ribosomal proteins.
Statistics
?
PSSM-Id: 401865
View PSSM: pfam10037
Aligned: 20 rows
Threshold Bit Score: 350.567
Threshold Setting Gi: 341901520
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001363041   2 MAAPIVRHGFLLARNVa--LSQFSl-AGKRCLLSAAYVDSQKWEAREKEQ----CNLADLA--------SLMDRTYER-- 64  gray short-tail...
PNI73393       1 MAASIVRRGMLLARQV---VLPQLspAGKRYLLSSAYVDSHKWEAREKEH----YCLADLA--------SLMDKTFER-- 63  chimpanzee
XP_001504081   1 MAFPMERFSMFLARRRl--VPAPAl-AGKRYLLSAAYVDSRKWEAREKEH----CHLADLA--------SLMDKTYER-- 63  horse
XP_002721154   1 MAAPIVRRGMFLARKVl--QPLLSq-SGKRCLLSAAYVDSRKWEARERED----CHLADLA--------SLMDNTYER-- 63  rabbit
EGT57455       1 MLSKHIIRALIPRRNIhktVRNPV--------LSQSFFLENEWSGRH-------VALGKLGlggdyewiSAVQKKFIG-- 63  Caenorhabditis ...
XP_001959426   1 MLRSRISCALPT--------RRLM------SYLSPEF--------------------NKLA--------NEGPKISAA-- 36  Drosophila anan...
O77477         1 MLRSRISCALPP--------RRLV------SYFSAEF--------------------NKVA--------HEGPAKFAAgs 38  fruit fly
EFA02747       8 ATRRGFLKTINSQ-------RSYL-----RTFLSQAYYCNEVWDSRLNSPllqkVNLDGLY--------YELDQGFQK-- 65  red flour beetle
Q16VX0         1 MLRQVLRTGYGF--------RPFL--TTHRNFLSEAYLCREAWQSRLATPvlskVNHEALY--------YELEQKFQQ-- 60  yellow fever mo...
EEB18161       1 MIKNLCNKSYNLSKNNnffVRLFK-----RSFLSESYKCIDEWENRLKHPifkkSNVDNIY--------NQLKLDFDT-- 65  human body louse
XP_001363041  65 KLPVSSLTISRFVDNISSREEVDHAEYYLYK--------------FRHSPNCWYLRDWTMHSWIRQCLKYGAQDKALYTL 130 gray short-tail...
PNI73393      64 KLPVSSLTISRLIDNISSREEIDHAEYYLYKkgecsssspqnysrFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTL 143 chimpanzee
XP_001504081  64 KLPVSSLTISRFVDNISSREEVDHAEYYLYK--------------FRHSPNCWYLRDWTIHTWMRQCLKYGAQDKALYTL 129 horse
XP_002721154  64 KLPVSSLTISRFVDNISSREEVDHAEYYLYK--------------FRHSPNCWYLRDWTIHTWIRQCLKYGAEDKALHTV 129 rabbit
EGT57455      64 GGYASAVDVDAAVCVAEQKDQVDDVIELLYK--------------LRHSVKAAEKLESSEYALVRLLLKY-QPETILTLA 128 Caenorhabditis ...
XP_001959426  37 SHVAANMDLDLFVNP---DNRPMDLVDRLAK--------------LRSQKEASLVPLFPS-VLVKQLLDSTNPQEAISVL 98  Drosophila anan...
O77477        39 SHAVTSVDLDVFVNP---DNRPMDLVDRLLK--------------LRKQKEASLVPLIPS-VLVKQLLDSTNPQETISVL 100 fruit fly
EFA02747      66 TRRISPVDVDIFANALKDDVFIDELLDLVHK--------------LRLSPDTGNTLNSTSHAVVRTLLRNDKVKELLQVL 131 red flour beetle
Q16VX0        61 KNKVSAIDIDIYANKLEDDSHIDEVADLIYK--------------FRLTEEASNVLQSTQHAIARNYIEHSQYGQLIEML 126 yellow fever mo...
EEB18161      66 NKRISVLDVDILANSFKDYNEKFEVEDTLKK--------------LRECPECVLLPERSTHAILRYYIDHGPKEDIFNLL 131 human body louse
XP_001363041 131 VNKVQYGIFPDNFTFNLLMDYFIKKENYEGALAVVFQIMLQEDFDTPSTQLLSLYVLYQCLAK----------------- 193 gray short-tail...
PNI73393     144 VNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAK----------------- 206 chimpanzee
XP_001504081 130 VNKVQYGIFPDNFTFNLLMDHFIKQENYKDALSVVFEIMRQEAFEAPSTQLLSLYVLYHCLAS----------------- 192 horse
XP_002721154 130 LNKVQYGIFPDNFTFNLLIDSFIKKENFQDALSVVFEVMLQEAFDAPSTQLLSLYVLYHCLAK----------------- 192 rabbit
EGT57455     129 NDPINYGVFLNPHLACIVIDHFIKTSNIQAAARIVTWMVQQEELDNELLNVLGLYVCAKWAELpadqqtlelggseeeed 208 Caenorhabditis ...
XP_001959426  99 RSPTQYGLFVDQFSGCYLMDVLLHNGNAVEAAQVAAILVERGLCNNELVEALALQSFYGYAKDfkpvvaepqdkpapka- 177 Drosophila anan...
O77477       101 RNPIQYGLFVDQFSGCFLLDFLLHNGHAVESAQLATILVDRNLCNNELLESLALQSFWSFAKEfkpfessqvqppakn-- 178 fruit fly
EFA02747     132 DDRLNYGVFLDDYTANILMDKFWKSKDFAAGCLVASQMMLQEDLKHPVTVNLALLHCYNYLLKpgdwlempqpeepee-- 209 red flour beetle
Q16VX0       127 DNRIGYGVFLDDFTANLALDRLVTTNEFKWAARIATLLGLQEDFGNPITRALATYGSYRYVKGgeidhfddlippppldp 206 yellow fever mo...
EEB18161     132 SNRLEYGVFPDFYLINMLMDKFLKNEDYVSAVKIAVLQMLQEEYGHPITKSLAIFSCYKYLLSsmvwsvppppepdpde- 210 human body louse
XP_001363041 194 -----------------------KSEFTWEEEKNF-GASLLLL-GLKQE--NPVYLSSQLYGYALLGKvelrqglravfr 246 gray short-tail...
PNI73393     207 -----------------------KTDFSWEEERNF-GASLLLP-GLKQK--NSVGFSSQLYGYALLGKvelqqglravyh 259 chimpanzee
XP_001504081 193 -----------------------KTDLSWEEERNF-GASLLLP-GLKQR--NAVGLSSQLYGYALLGKvelqhglravyh 245 horse
XP_002721154 193 -----------------------KTDLNWEEERNF-GAALLLP-GLKQQ--NSVGLSSQLYGYALLGKvelqrglravyh 245 rabbit
EGT57455     209 v----ndddirtfkfpylknecfDEHFDLTNPHHLiGKSLQWLsRDTQSidKDLKSSLNALGAVLFEK------------ 272 Caenorhabditis ...
XP_001959426 178 --------sdvekvrvkfirnyhEDPSEKTEEKKL-GRAMVKI-GSGEGslKDLKQNIALLGYVIAGQ------------ 235 Drosophila anan...
O77477       179 --------vevekvrvkfirnypDDASENTEEKKL-GRAMVRL-GSGEGslKELKQNVALLGYVLTGQ------------ 236 fruit fly
EFA02747     210 ---------evkirvnyirnpfnDEHFDLREPQKIvGKTLA---AATRDrnDSLHNSLRIIGLALFGKee---------- 267 red flour beetle
Q16VX0       207 aevkkkkkdevkvrvkflrneffDDHFDLRDSKLLlGKTFYTL-GLSHGa-GVVGDSCRLLGLVLHEK------------ 272 yellow fever mo...
EEB18161     211 --------dvvkvrvpyirnpyfDDHFDITEPNHLvGKTMWLF-GKNIN--GPLGISSQLVGLILYEK------------ 267 human body louse
XP_001363041 247 dmplmwtpgyLDRALKVMEGMLSSPGDMKLCKEALDALETVLTSLlaspsdgppsegaqaaevrpqeseprdqlDAEESE 326 gray short-tail...
PNI73393     260 nmpliwkpgyLDRALQVMEKVAASPEDIKLCREALDVLDAVLKALtsadgaseeqsqnd--ednqgseklveqlDIEETE 337 chimpanzee
XP_001504081 246 nmpllwqpgyLDRALQVMEKVASCPEGEKLCGDALDVLDRVLKAVtapaptsseeqpre-gedgqrpaelveqmDVEERQ 324 horse
XP_002721154 246 nmplmwkpgyLDRALQVMATAASSPEDRKLCREALDVLDAVLKAVtspaaealeeqpqe-gegtlgpahlveqlDIEETE 324 rabbit
EGT57455     273 ----------LQEAGSTVS---------TAHSSVKQLIAERLAPK-----------------------------EREEQP 304 Caenorhabditis ...
XP_001959426 236 ----------LADASSFLEKNKQ-----SFHKDTLTAAQSAAEGS-----------------------------KLEGAE 271 Drosophila anan...
O77477       237 ----------VPEASSFLASNSA-----ALHKETLLAAQSIVESL-----------------------------KLEGSE 272 fruit fly
EFA02747     268 ---------lVKKEMEARKNT-------KLIKQVVQLL------------------------------------------ 289 red flour beetle
Q16VX0       273 ----------WAKAAELLETGS------EMNADVLKLARNFLEKV-----------------------------ENKEGE 307 yellow fever mo...
EEB18161     268 ----------FNETISLLNTIIEKDL--KLHSQAVSMAKDFLTNKp----------------------------KQDSSD 307 human body louse
XP_001363041 327 QSKLPKYMDQFKLLRSKLEALGRVEPEALLTLTAQLVQEELPACETEDIQNYEQKLKQWEQEQAELIQREKTTWEKARRE 406 gray short-tail...
PNI73393     338 QSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQE 417 chimpanzee
XP_001504081 325 QSRLPQYLERFQAARSQLQALGRVESGSLLTLTTQLVHEELPTYEAEDMAAYEQQLQQWQQERARLVQREQEQRERAKQE 404 horse
XP_002721154 325 QSKLPQYLERFQALQAELQALGRVESESLVTLTTQLVKEQLPSCEAEDLATYEQKQQQWRQEQVQLIQREQEQREKARKE 404 rabbit
EGT57455     305 -----EEQKAILEKIGTVEKSNQLLSDIILEHLTRIQ----KAEEEKLCSQQTALFATWNERRQELAKSQAQKVLLRIRQ 375 Caenorhabditis ...
XP_001959426 272 -----ELVKSLQDALEKTT-----KTNAIAEQLENSVKSSAQKYEPKLLADYGDSYQKWAVEFEKAVSKKTEERSLDLRR 341 Drosophila anan...
O77477       273 -----ELLKSLQEAVEKSS-----KSNAIQSLLENSVKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEERK 342 fruit fly
EFA02747     290 -----PDDNPFKADLTQLE----LVSEDVQTILEKQLTESIAVTSEKDIANQCSLFKQWENERLQALEEQKKRLHTLERL 360 red flour beetle
Q16VX0       308 ------EYGKLVEALGKFESSAKLNNESFEKILLAEVNKSVAENEQRQITEQAKIYNEWCDVRQQRLDEELARLQRAKRI 381 yellow fever mo...
EEB18161     308 -----SIKNEILQLLTKINSKNLLKTD-LLTESENLLKHSIENNERNDIDNQCKIYSRWENDRNEHINKELERSEIENLK 381 human body louse
XP_001363041 407 QEARKASK 414 gray short-tailed opossum
PNI73393     418 YQAQKAAK 425 chimpanzee
XP_001504081 405 HEARRAAQ 412 horse
XP_002721154 405 HQARQAAK 412 rabbit
EGT57455     376 DEIRAELK 383 Caenorhabditis brenneri
XP_001959426 342 DNINKTLS 349 Drosophila ananassae
O77477       343 ATIQKTLS 350 fruit fly
EFA02747     361 AEVERMKK 368 red flour beetle
Q16VX0       382 QDMEQMAR 389 yellow fever mosquito
EEB18161     382 MEIAKVKE 389 human body louse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap