Conserved Protein Domain Family
Dpy19

?
pfam10034: Dpy19 
Q-cell neuroblast polarisation
Dyp-19, formerly known as DUF2211, is a transmembrane domain family that is required to orient the neuroblast cells, QR and QL accurately on the anterior-posterior axis: QL and QR are born in the same anterior-posterior position, but polarise and migrate left-right asymmetrically, QL migrating towards the posterior and QR migrating towards the anterior. It is also required, with unc-40, to express mab-5 correctly in the Q cell descendants. The Dpy-19 protein derives from the C. elegans DUMPY mutant.
Statistics
?
PSSM-Id: 401862
View PSSM: pfam10034
Aligned: 48 rows
Threshold Bit Score: 492.115
Threshold Setting Gi: 225632212
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002071812          18 GFFFLYMQHVRVIFETRTNIHQLSQLEKESLIRNEDALYYSFYKKLVDGPNFWH-GYEQLKNVTDIEYPQSVNVLQRFYV 96   Drosop...
CAX64097              16 CAFVTLTFYKRYRYGFDRNY-----VEQKLSLYSEESFYFSFYNDIVKSNTFGE-GINYLLKDNRSEYPDTINAIKRFNI 89   Plasmo...
Q5CR43                48 LSSIIFSSFLILRHRKMLLRSYE---EQKMSLFSETAFYFSFYDDIVNSSESIYnIIKKMISDDRTEYPDIINSLSRFNI 124  Crypto...
XP_001965532          18 GFFFLYVLHVRVIFETRTNIQQLNQLEREALLRREDALYFAFYKRLAESPNFWH-GYEQLKNVTDIEYPHSVNVLQRFYV 96   Drosop...
Q9VWR8                18 GFFFLYVQHVRVIFETRTNIQQLNQLEREALLRREDALYYAFYKQLAEGPDFWH-GYEQLKNVTDIEYPHSVNVLQRFYV 96   fruit fly
WGS:AANI:GJ18594-PA   18 GFFFLYMHHVRVIFETRTNIRHLNQLERESMLRREDALYYTFYKKLADGPDFWH-GYEQLKNVTDIEYPHSVNVLQRFYV 96   Drosop...
XP_015042229          18 GFFFLYMQHVRVIFETRTSIQTLNQLEREALLRREDALYYTFYKKLVDGPDFWH-GYEQLKNVTDIEYPNSVNVLQRFYV 96   Drosop...
EEB14644              27 GFAFIHMHHVSTLFENDRHFSHLSNLEREMTFRTEMGFYYHYYKKIINAPSFES-GLKALLQDNQTEYPDVINALQRFNL 105  human ...
EFN81712              33 SFGYLHSLHVSTLFENDRHFSHLSEIEREMSFRTEMGMYYSYYKTIAESKDFFE-GMDKLIHDNLSEYGNVIDASRKYNL 111  Jerdon...
XP_008202731          18 ACGILHRWHASTLFENERHFTHLSEMEREMSFRTEMGMYYSYFKTIADSATFFE-GMQRIHHDNFSEYPNIINAESKYNL 96   jewel ...
XP_002071812          97 LPELVTAY--------VFHIVRSGYNP---------------------------------ILQPMQFYFEFVWIMGGVTL 135  Drosop...
CAX64097              90 YPEIILGA--------LWKGLNle----------------------------------syILTPYNFYVYAVIFLQAASV 127  Plasmo...
Q5CR43               125 YQEVILGI--------LYKLFLEFYFKlkfiihliysfingehllkntfgfnnlssefvfLSTPYNFYFFFVNSLLGIGM 196  Crypto...
XP_001965532          97 LPELVTAY--------FFHIVRTGFNP---------------------------------MVQPMQFYLEFVWLMGGVTL 135  Drosop...
Q9VWR8                97 LPELVTAY--------FFHVVRSGFNP---------------------------------MVQPMQFYLEFVWLMGGVTL 135  fruit fly
WGS:AANI:GJ18594-PA   97 LPELVTAY--------FFHIVRAGFNP---------------------------------SLQPMQFYFEFVWLMGGVTL 135  Drosop...
XP_015042229          97 LPELVAAY--------FFHLVRSGYNP---------------------------------ILQPMQFYFEFVWLMGGVTL 135  Drosop...
EEB14644             106 YPEVFIGG--------LYRIFDFVTKRydittkqcwevnr--------gqslppvnscegLGDPMYFYLEFVWYCAGLSK 169  human ...
EFN81712             112 LPEIVIGF--------LYHAAKNLGIVseeqcwvverg-----------dglpnvtscegLGVPVYFYLEIVWFTAMFTA 172  Jerdon...
XP_008202731          97 GPEV--NIgmfyhimkYLDLL-----Pkplcwqiergd------------glasitscegIGVPVYFYLEFVWLCAMVTG 157  jewel ...
XP_002071812         136 LVLYLYGIMLSENVF-GGIYGVISYLMFHSF--AAKIYERPLARENFAFPFIFLQMFYLCFCIGQViytqRHS--SRLlk 210  Drosop...
CAX64097             128 SVLFFFSVYIGKSYF-PGVIFLMLFFSCFREkfIMRLS-AFPLRENFASVFMWCNIILIYIILKDKei--------pIlk 197  Plasmo...
Q5CR43               197 GVLCGTSTFIADGSYiSGLTCMGFLFANFRLrlLSRIS-SLPLRENFALPFIWINNMILISIIKYTnrgnQKKk------ 269  Crypto...
XP_001965532         136 LVLYLYGTLLSENVF-GGIYGVISYLMFHSF--VAKIYERPLARENFAFPFIFLQMFYLCICIGRIihrqRHT--SRLfm 210  Drosop...
Q9VWR8               136 LVLYLYGTLLSENIF-GGIYGVISYLMFHSF--VAKIYERPLARENFAFPFIFLQMFYLCICIGRIihrqRHT--SRMfm 210  fruit fly
WGS:AANI:GJ18594-PA  136 LVLYLYGTLLSENVF-GGIYGVLSYLMFHSF--AAKIYERPLARENFAFPFIFLQMFYLCICIGRVlhrqKHT--SRIfm 210  Drosop...
XP_015042229         136 LVLYLYGTLLSENVF-GGIYGVISYLMFHSF--VSKIYERPVARENFAFPFIFLQMFYLCICIGRVihrqKHS--SRLfm 210  Drosop...
EEB14644             170 AVLFIYAVVLSNS-FgGGLLTVLGFLFNHGH--CTRVQWTPPLRESFAYPFCLSQMLAITYCLKSSknkiNTKw-NLLfq 245  human ...
EFN81712             173 TMLFYYATYLSDSVY-GGLLAILLFFFNHNE--CTRVQWTPPLRETFAYPMLLFEMYSVTLAIKKYakhdSDKepSWLkg 249  Jerdon...
XP_008202731         158 FTIFLYASNLSGSIG-GGIIAVAAFFFNHTE--CTRVQWTPPLRESFAYPALLFQMFMMSEILKKRkkpdSMSt------ 228  jewel ...
XP_002071812         211 ------iFTMSIFIAIALLSWQFSTFIFTTQILIVMTSWNISVMPTGtanAFALdFSISHLLGNALAFIISHGNGQLLFT 284  Drosop...
CAX64097             198 ------yIGLFFSSLLCFLFWQFSVFVSVTHIVSLFIVDLLG---YNiinKLNN-ILFIFCFSYLLSITLTFFPRYLLCT 267  Plasmo...
Q5CR43               270 ------wILLYFTSVILLEFWQFSVFVISTQILSVYALFLFGCEHSKlilVLRK-LIFFNMIAMFTSYLLHFFNYYILLT 342  Crypto...
XP_001965532         211 ------iFAMAVFTACAMLSWQFSTIIFTTQIIIVMTSWNLSALPTGlanSFAFdYSLSHILAHALAFILSHGNNQLLFT 284  Drosop...
Q9VWR8               211 ------iFAMSLFTACALLSWQFSTFIFTTQILIMMTSWNASALPTAlvnAFVLdYSLSHLLGHALAFVMSHGNSQLLLT 284  fruit fly
WGS:AANI:GJ18594-PA  211 ------vCVMSLFTACALLSWQFSNFIFTTQIMIVMTSWNVSSMPVGlanAFALdYSLSHLLGNCLAFVISHGNTQLLFT 284  Drosop...
XP_015042229         211 ------iFVLSMFTACALLSWQFSTIIFATQIMIVMTSWNINTMPTNvanAFALdYSLSHLLGNAIAFVLSHGNSQLLFT 284  Drosop...
EEB14644             246 ------vWTITLSSTSSLLLWQFSQFVLATQVVAILIMFCLGIIHKK---TVLI-ILVSQLVGLLQAAVLMFGNEFLFQS 315  human ...
EFN81712             250 rtrqglfVDIFGSTICSLCTWQFSHFVFATQITVLLILKWLRIVPYD---FYKN-FCMTHALAIAAATNITNG-TLIVSS 324  Jerdon...
XP_008202731         229 ------hVDLVLLMAFCLLSWQFSQFVFVTQTIALLILKWFKIINQE---VYSF-YCIVHLLSVTSVIGLT-SNAFLLNS 297  jewel ...
XP_002071812         285 WQLSVSLSLFLITMV---RQVRSRRltndpl--qgdyfsLKF-------------------------------------- 321  Drosop...
CAX64097             268 YFPYVLIAILITNVI---FNYFSKKkkddvnnnnnnnniYNMnetnnqhsktctfvrttkeknheminnnkinnlknnnn 344  Plasmo...
Q5CR43               343 PLPQIGVSILLSISL---CKILFKRe------------kFSL-------------------------------------- 369  Crypto...
XP_001965532         285 WQLSVSFSLFLITVVrhvRQVRSRRqghhdpl-qgdyfsLKF-------------------------------------- 325  Drosop...
Q9VWR8               285 WQLSISLFLFLITMVrqlRHVRSRRlghaqdllngdlfsLKF-------------------------------------- 326  fruit fly
WGS:AANI:GJ18594-PA  285 WQLSVALSLFLITIV---RQLRNRRctnnvl--qgdyfsFKL-------------------------------------- 321  Drosop...
XP_015042229         285 WQLSVSISLFLITVV---RQVRSRRhvndpl--qsdyfsFKF-------------------------------------- 321  Drosop...
EEB14644             316 ILFSLLISSIAIVLSc---------------------------------------------------------------- 331  human ...
EFN81712             325 LYMCLLISSNAASLIvklSRFQNIK------------------------------------------------------- 349  Jerdon...
XP_008202731         298 LHLALLIVSVCASELg--KALSNRVna----------------------------------------------------- 322  jewel ...
XP_002071812         322 ---------------------------------------ILLALL--------FASSMQAKLLDLLVKAGMLNPQDNtcv 354  Drosop...
CAX64097             345 hpcnnynsynqceerknedindkptnkynkeislftlfkNLYIIKnwifilkkGLTSIFIFLILRLII--FSKDKDDshv 422  Plasmo...
Q5CR43               370 ---------------------------------------LYSFTS--------GIISLALFLVFKLILNPF--SDHDthv 400  Crypto...
XP_001965532         326 ---------------------------------------ILLALL--------FASSMQGKMLELLCRAGVLSVADGpht 358  Drosop...
Q9VWR8               327 ---------------------------------------LMLTLL--------LASSVQTTLIELFNRAGVVSVTEGdqq 359  fruit fly
WGS:AANI:GJ18594-PA  322 ---------------------------------------ILLALL--------FASSMQGKLVDLLSKSGLLNWQDNtym 354  Drosop...
XP_015042229         322 ---------------------------------------ILLALV--------FAGSMQEKLVDVLRRTGVLNVQDNnyv 354  Drosop...
EEB14644             332 ---------------------------------------DFKIHYpsfhggfiLISSLVITFSLKSKISRFFS-EHDahi 371  human ...
EFN81712             350 ---------------------------------------YEIILE--------IVMTVIFTKWIK---SYVLYSQDDahv 379  Jerdon...
XP_008202731         323 --------------------------------------kTLTVLE--------ITATLLGTNLWKVLFT---SGSDDehi 353  jewel ...
XP_002071812         355 hycdlwAHWalQMKVNFVTNLS-ACNPHYVPVAWSELWQLVKTLIVkpycmYGVVMLAMFfrkwrksnVpqraasqeqre 433  Drosop...
CAX64097             423 i-sllkVRLk-LANHNFDTMLY-SSGSEFNPFSKYMFHMLKESAVY-----EYFIIFNIL--------F----------- 475  Plasmo...
Q5CR43               401 f-dmlkSAIfgQEFANFDTMIYkMGGSEFSFITKEQLEMIKNSGVLfifipGTFLILFSIiidtanirAskyfpyknies 479  Crypto...
XP_001965532         359 hyselwAHWalQIEVGFVTNLS-ACNPLYARVAWPELWQLVKTLIVkpycmYGVVMLAMFfrrwrksgApvsaiseeqre 437  Drosop...
Q9VWR8               360 hffdicAHWalQVNVGFVAHLS-ACNPQYARVAWSELWQLVKTMIVkpycmYGVVMLAMFfrrwrksgApvsalteeqre 438  fruit fly
WGS:AANI:GJ18594-PA  355 hycdlwAHWmlQAKVNFVTNLS-ACNPLYARVAWSELWQLVKTLIVkpycmYGVVMLATFfrkwrksnVitkanqeqrer 433  Drosop...
XP_015042229         355 hywdlwAHWafQVNVNFVTNLS-ACNPLYARVAWSELWQLVKTLIVkpycmYGVVMLAMFfrkwrksnVpttasqeqrer 433  Drosop...
EEB14644             372 f-dlllAKV--TNFKNFHTMLY-TCSPEFDFLPLSTVYELTITGLI-----PTVLIVIGI--------L----------- 423  human ...
EFN81712             380 f-nilkSKL--TDYRDFHTMLY-TCSAEFDFLQYKTYETIVKTLLL-----PTAILTGML--------A----------- 431  Jerdon...
XP_008202731         354 f-nilkSKI--SNYKDFHTMLY-TCSAEFDFLKYETYEAIVKTFLL-----PTAILAGFL--------V----------- 405  jewel ...
XP_002071812         434 rarnyvledfleehrvsmsemsnkqteqqlqkCLKMLESCDHDYERYKREKAKMQQEQPAERDDFIADikrlkeqinrnk 513  Drosop...
CAX64097             476 --------------------------------FIYILNYCKQLLKGKQTQQYHIFKSS---------------------- 501  Plasmo...
Q5CR43               480 sfsyqf---------edcsqindeisdsssnsSIVSTAASYSPEAAISLKQSNVHCFKNNLQDEYPKNlkekqssyknkk 550  Crypto...
XP_001965532         438 rarnyvledfleehrvsmgdmsnkqtearlqqCFRLLDSCDHDYERYKRTQARLRQEPPAARDNFMQDirrlkeqihrns 517  Drosop...
Q9VWR8               439 rarkyvledfieehfvsmsdmssketekqlykCFRLLKSCDYDYERYKRAQASLRKEQPPARDDFMQDikrlraqinrns 518  fruit fly
WGS:AANI:GJ18594-PA  434 arnyvledfl-eehhvsmsdmsnkqteqqlqqCFAMLESCDHDYERYKREKAKMQQEQPPERDDFMQDikrlkaqihrns 512  Drosop...
XP_015042229         434 arnyvledfl-eehhvsmtdmsnkqteqqlqqCFKMLESCDHDYERYKLKKAKLQQQQPPARDDFIKNikrlkaqihrns 512  Drosop...
EEB14644             424 --------------------------------LFKWGKHFIFKKQKHGQSQNVIDPE----------------------- 448  human ...
EFN81712             432 --------------------------------LYYWYRSFKIGDYPRCIEAD---------------------------- 451  Jerdon...
XP_008202731         406 --------------------------------LYYWYRNLKGQGFPNCIEPH---------------------------- 425  jewel ...
XP_002071812         514 ereqgenkdelqqqqaqtqdteaektfipasdpaadststtttttntinatkdkekteetlpskttdettnkssssssss 593  Drosop...
CAX64097                 --------------------------------------------------------------------------------      Plasmo...
Q5CR43                   --------------------------------------------------------------------------------      Crypto...
XP_001965532         518 dkqrkeraqetkeagggdvpdpmptekeemfreddiekedla---------------------------setlpsmsrse 570  Drosop...
Q9VWR8               519 vkqrkeraqetkeaatdgastpteeedkdpeaeseskkknqepgsget----------------etesaadptetppsrs 582  fruit fly
WGS:AANI:GJ18594-PA  513 dkqrkereqasesnlketssiesectaeadtetqaqt--------------------------------------atake 554  Drosop...
XP_015042229         513 dkqrkerqqgataatmdtkeeepleqepdqdkdqepdhvntetvvheadevh-------hetdetqpsmsateekampap 585  Drosop...
EEB14644                 --------------------------------------------------------------------------------      human ...
EFN81712                 --------------------------------------------------------------------------------      Jerdon...
XP_008202731             --------------------------------------------------------------------------------      jewel ...
XP_002071812         594 pnrnghssshthnhnhshsrchrshrnsmsstssfsvvpttnaQILNLHYMYSFLQMLVFTVIGLTVRKLFFLSFTQGCV 673  Drosop...
CAX64097             502 -------------------------------------------------FIFLIYQLVFFILLMLIISRLRVLALPLICL 532  Plasmo...
Q5CR43               551 -------------------------------nllldkfyninfENQDTAISFLTFQTIFFCLLAIIISRLRVLALPYIAV 599  Crypto...
XP_001965532         571 deqnndeqpdpdekeqpmpssnerrpkrsssarrssvvptanaQILSLHYVYSFIQMLVFTVVGLAVRKLFFLSFTQGCV 650  Drosop...
Q9VWR8               583 adneeeeeehsataagcgsnssghrqrkrsssrrssvvptanaQILNMHYVYSFLQMLVFTLIGLAVRKLFFLSFTQGCV 662  fruit fly
WGS:AANI:GJ18594-PA  555 tqnetetdetqpcktpsdkepangrrrpatsarrdsviptanaQILNLHYMYSFMQMIVFTLIGLTVRKLFFLSFTQGCV 634  Drosop...
XP_015042229         586 gngrqkapgagagaapkpkpnanataktpsrrssssvvptantQIFNMHYMYSFLQMLVFTILGLAVRKLFFLSFTQGCV 665  Drosop...
EEB14644             449 -------------------------------------------------VVYNFLQLGAFTIMTYFIMRLKLFWSPHLCL 479  human ...
EFN81712             452 -------------------------------------------------VAYNGLQTGAFIIMAVFIMRLKLFMTPHLCI 482  Jerdon...
XP_008202731         426 -------------------------------------------------IAYNILQTGAFTVMAMFVMRLKLFMTPHLCI 456  jewel ...
XP_002071812         674 IAPTVCSKVW---------YHRQRN--------------------------------IFWSVSLAVFLLSMFDPGMVNIR 712  Drosop...
CAX64097             533 FSSLVGSPHFlddlyfltsQNFLKSkrtnk----------------------grlhkIIIFSICLVQCAYPFKKYFPQYE 590  Plasmo...
Q5CR43               600 VSSLFASRKY---------LSFIFNyykpillwifrikynknkainpnkryfnnriaCFIFFATSIIFLSFSISKFPFSE 670  Crypto...
XP_001965532         651 IAPTICSKVW---------YHRQRN--------------------------------IFWSVSLAVFLLSMFDPGMVNIR 689  Drosop...
Q9VWR8               663 IAPTVCSKLW---------YHRQRN--------------------------------IFWSVSLAVFLLSMFDPGMVNIR 701  fruit fly
WGS:AANI:GJ18594-PA  635 IAPTVCSKIW---------YHRQRN--------------------------------IFWSVSLAVFLLSMFDPGMVNIR 673  Drosop...
XP_015042229         666 IAPTICSKVW---------YHRQRN--------------------------------IFWSVSLAVFLLSMFDPGMVNIR 704  Drosop...
EEB14644             480 MASLIMSTKYlss------------------------------------------knNLRYSILTILIAAMSYHGINNII 517  human ...
EFN81712             483 IAGAVCSKRYlekvg--------------------------------------lkseLARAAVIFLLVSGMSYHGVDRIQ 524  Jerdon...
XP_008202731         457 LAGLSCSKRYleklg--------------------------------------ikrkAMQGALVALLLAMMSYNGVQRLI 498  jewel ...
XP_002071812         713 EEYFPTRYTQNTDDlDSMLEWIKVNTERDAVFAGPVEIIGTVHLTTKRPIVNHAHLEMRQIAERTEHVYSVYSRQQSSDI 792  Drosop...
CAX64097             591 YMNMINNEPINLQKnLDLIIWLKKNIKEGEALISDIPTSSFLRCTTNYKFVLHPQYEDSNLRKRVQDYYMFSACLPFSDG 670  Plasmo...
Q5CR43               671 IQTGLIPENNASSSkSRLVGWINSNLPNHTPILSDMVVSATLRLATKTKIVTHPQYEHIKIRRRTQFMYSISACISLKEL 750  Crypto...
XP_001965532         690 EEYFPTRYSQSPDDlDSMLEWIKLNTERDAVFAGPVEIIGTVHLTTKRPIVNHAHLDMRQMAERTEHVYSIYSRQQSSDI 769  Drosop...
Q9VWR8               702 EEYFPTRYSKSGDDlDSMLEWIKLNTERDAVFAGPVDIIGTVHLTTKRPIVNHAHLEMRQIAERTEHVYSVYSRQQSSDI 781  fruit fly
WGS:AANI:GJ18594-PA  674 EEYFPTRYTQSSDDlESMLEWIKLNTERDAVFAGPVEIIGTVHLTTKRPIVNHAHLEMRQMAERTEHVYSVYSRQQSSDI 753  Drosop...
XP_015042229         705 EEYFPTKYEHNADDlESMLEWIKLNTERDAVFAGPVEIIGTVHLTTRRPIVNHAHLEMRQMADRTEHAYSVYSRQQSSDI 784  Drosop...
EEB14644             518 RQRNIMGEYINIPF-EEVLTWISSETLPTDVFAGPMSIMANVLLSTGRRIVNHPHYEHHNMRERTLKVYSVFSRQNPQQV 596  human ...
EFN81712             525 QEHGFIGEYSNIEQ-EELFEWIKSNTPKHAVFAGKMSLMANLMLSTRRPIVNNPYYESKEMRDRTMRVYEIFSRKDVASV 603  Jerdon...
XP_008202731         499 KEREFIGEYSNVDQ-EELLEWVQAKTPRSAAFAGKMSLMANIMLSTRRPIVNNPYYESKEMQERTMKVYEIFSRKSVAEV 577  jewel ...
XP_002071812         793 YNQC-SQLKIQYLIISLDECTNEVR--DDCDILSIWDDKQ------PTYRNYP-QFCHEL---LHKNVPsFLKVYANDNY 859  Drosop...
CAX64097             671 KKYIfEKYKSRYFISNIYRCSSSG---SKINVFTISDKIDsnyarcEKKRKTM-RFCNRVlydDKNYKTlFR----NGKF 742  Plasmo...
Q5CR43               751 YETMqQQYKTEYLLLSIYRCAIPRGdkNAITMIHVTNFLDninhrcNNQENIFqRTCWRIq--LDSQSRyFDLVYRNAHY 828  Crypto...
XP_001965532         770 YNQC-ARLKIQYLIISLDECKNEVR--DDCDVLAIWDEKQ------PAYRKYP-QFCHEL---LHKNVPsFLKVYANDHY 836  Drosop...
Q9VWR8               782 YNQC-AQLKIQYLIISLDECTNEVR--DDCDLLAIWDDKQ------PAYQKYP-QFCHEL---LHKNVPsFLKVFANDHY 848  fruit fly
WGS:AANI:GJ18594-PA  754 YNQC-TQLKIQYLIISLDECSNEVR--DDCDILSIWDDKQ------PAFRKYP-QFCHEL---LHKNVPsFLKVYANDNY 820  Drosop...
XP_015042229         785 YKQC-AELKIQYLIISLDECTNEVR--DDCDLLSIWDDKQ------PANRKYP-QFCHEL---LHKQVPsFLKVYTNDNY 851  Drosop...
EEB14644             597 FSTL-IDMGVDYVILDETWCFYQSR--ENCSMIDLWDLVD------LENANNE-PLCPKLf--NGNPEP-FIRAFANDVF 663  human ...
EFN81712             604 YTSL-RGLKVGYVVLEEPLCFGFANlpRGCQMIDLWDVTDng---tSRAANKP-PLCPLLf--QGNAYP-FKRAFVNSNY 675  Jerdon...
XP_008202731         578 HDTL-RKLQVDYVVIEEALCYGYGYwkPGCKMLELWDLVDng---kGKSEGKI-PVCPMLf--RGNAHP-FRRVFENRSY 649  jewel ...
XP_002071812         860 GIIKM 864  Drosophila willistoni
CAX64097             743 SVIYf 747  Plasmodium falciparum 3D7
Q5CR43               829 SLYKr 833  Cryptosporidium parvum
XP_001965532         837 GIIKM 841  Drosophila ananassae
Q9VWR8               849 GIIKM 853  fruit fly
WGS:AANI:GJ18594-PA  821 GIIKM 825  Drosophila virilis
XP_015042229         852 GIIKM 856  Drosophila pseudoobscura
EEB14644             664 VILSl 668  human body louse
EFN81712             676 VVLQl 680  Jerdon's jumping ant
XP_008202731         650 VVLQl 654  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap