Conserved Protein Domain Family
DUF2270

?
pfam10028: DUF2270 
Predicted integral membrane protein (DUF2270)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401857
View PSSM: pfam10028
Aligned: 41 rows
Threshold Bit Score: 174.305
Threshold Setting Gi: 506407799
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Mnod_2279             34 AHYYRGEIARATGWRDRIDRTTNWAITLIGAMLSVSLAAPVEQHGILLFAMMLLLVFLIVEARRYRYFDVYRVRLRQLER 113 Met...
jgi:Haur_4101             49 VHLYRGELTRANTWRVRLDGTTNWAVLTTGATLSFAFSSPSNTPVMILLNSLLIMFFLFIEARRYRFYDLWRTRVRVMET 128 Her...
Q0C4W7                    29 SHLYRAEVYRSTVWRQRLDQTTNWAVISTGIGLSVAFANERASPFPIVLVGMLCIVFLMLEARRYRFFYVWRFRARVIEI 108 Hyp...
PRJNA391730:Sp245p_34815  22 SHLYRAEIYRSTVWRTRLDATTNWAVVTTGIALSLTFSSATASPLPLVLVGLLVAVFLYIEARRYRFFDFWRIRAHVLEL 101 Azo...
Q89CF4                    24 AHLYRGEVYRSTIWRTRLDNTTNWAIVTMGIALSTTFSSPEASPLPLVLVGLLLAVFLGMEARRYRYFNVWRARARWLER 103 Bra...
WP_011747981              20 AHLYRAEIYRSTIWRTRLDTTTNWSVVTLGVALSITFSSPQASPLPLVLVGILIIFFLMLEARRYRYFNVWRARCRWMEL 99  Par...
CCA90799                  20 AHLYRGEVYRSAVWRTRLDTTTNWSVVTLGIALSITFASPDASPLPLLLAGILILFFLLLEARRYRYFNVWRARCRWMET 99  Nov...
jgi:Deipe_2242            27 IHLYRAEVGRMTMYRVRLDTTTNWAVGITAGLLGFAF-TPEGPHAALLAAMLANYFFLHVEARHFRDFEIAHLRVRILER 105 Dei...
WP_013615363              23 IHLYRGESYKMVSYRQRLDHTTNWAVVTTAGLASFAMGDAAHSHATFLFAMFMNFYFLRLEARRFRSYEIAHHRVRVMER 102 Dei...
WP_011531375              30 IHLYRAEVGKMTAYRQRLDMTTNWAVVTTAGLASFALGDPNNSHATFLFAMFMNFFFLRLEARRFRIYEVAHHRVRIMER 109 Dei...
jgi:Mnod_2279            114 HYLAQIFAPT-QEKGADw--tFLVAEDLRRPVFLMTYMDALTRRLRRNYLWMFLILLSAWILKIASAGNSScivpvqpaS 190 Met...
jgi:Haur_4101            129 EFFADMLAPEpDSDTGGphwrELLAQDLMEPHFNISLLEAMSRRLRRNYVWIFALLALSWVTKVGIHPTIA--------Q 200 Her...
Q0C4W7                   109 AFYVPILRGEgTKIRIDr--gTALSDDYEKPQYRISMLRCIGRRLRRNYGWIFAILGAAYFAKIAIHPVDV--------T 178 Hyp...
PRJNA391730:Sp245p_34815 102 YFLGPILRGQgDQFARGw--nETLFQDYQHPNLHITYLEAVGRRLRRNYGWIFLIQVVAYLGKLMIHPVPL--------S 171 Azo...
Q89CF4                   104 NFYAPIFTGE--AHDDSw--kAVLARDYTAPRHHISFVRATGRRLRRNYVWIFAIQATAYYGKIAIHPTPA--------M 171 Bra...
WP_011747981             100 NFMAPMLNDGdLRMDTGw--qDRLAEDYRRPAYHVSLRTAIGRRIRRNYFWILLIQTAAYLGKLAVHPAAL--------Q 169 Par...
CCA90799                 100 HFFASFLNGDnGRHEEEw--qQTLARDYLRPRYHIPLQVAIGRRIRRNYFWILLIQTTAFVSKIVVHPTPI--------E 169 Nov...
jgi:Deipe_2242           106 NFYPSMLGQEvSSEw-----qSYFVRELQRPHVRPDRLQAIGWRLRHNYQWIFLGVLAAWLFKLELGTTGQp------eD 174 Dei...
WP_013615363             103 FFYPAMLGEHvDAGw-----hQFLLAELAKPRSPISIREALGWRLKRNYLWIYAAVLIAWLAKLAETYPANt------pI 171 Dei...
WP_011531375             110 FFFPAMLGEKvDPGw-----hQLLLAELAKPRSPMSRLDALGWRLNRNYLWIYAAVLLAWFAKLDLDQPKGw------vL 178 Dei...
jgi:Mnod_2279            191 LLQKVADRAALGPLPGQVIVVVVCVLYGALLI 222 Methylobacterium nodulans ORS 2060
jgi:Haur_4101            201 SFGEVYDRAAVGPLPSWFMLLFGAAFNGGLVW 232 Herpetosiphon aurantiacus DSM 785
Q0C4W7                   179 SWEQLFRRAHIGPIPGWVAITGGCLFHVGWIF 210 Hyphomonas neptunium ATCC 15444
PRJNA391730:Sp245p_34815 172 SLDELFARATIGPVPGEIVLLCGMAFHGTWMA 203 Azospirillum brasilense Sp245
Q89CF4                   172 TLTELIDRAAVGPIPGWVVLIVGFAYNFGWLA 203 Bradyrhizobium japonicum
WP_011747981             170 SFGELLERAAVGPIPGWLVLGVGLLYCFSWGA 201 Paracoccus denitrificans
CCA90799                 170 HVSQLAQRSAIGPVPGELVLGLGALYCLAWGC 201 Novosphingobium sp. PP1Y
jgi:Deipe_2242           175 SFRLFVSMASLDFIPGALVFSLVLMFYLILFL 206 Deinococcus peraridilitoris DSM 19664
WP_013615363             172 SADAFVQTARVGTLAGWAVLLGVAAFYAYLIS 203 Deinococcus proteolyticus
WP_011531375             179 EFPQALALADIGNFPGWLVFLGVFVFYAFLIG 210 Deinococcus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap