Conserved Protein Domain Family
DUF2268

?
pfam10026: DUF2268 
Predicted Zn-dependent protease (DUF2268)
This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function.
Statistics
?
PSSM-Id: 401855
View PSSM: pfam10026
Aligned: 19 rows
Threshold Bit Score: 170.958
Threshold Setting Gi: 81644504
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q181L7         91 WATCKETIENSINAFIKE-GYDLNikdykysILLANPNSPYTILSDGYWGDGGIPGYIFLSl-VPNEYTIN----RLPVL 164 Clostridioides...
WP_012370079  141 QQQIKKSLQTSIDALPRTdKLTVF-------VAPYNVHNPAEIKRHGGVTGFASGTDMFTLy-LAKGFSTD----TLANA 208 Exiguobacteriu...
WP_012370163  129 KDIITKNYSASYEALPKK-KATIF-------IAPSNLEFWSMTDPLAGVSGAAFQDSIIIQ--LNPNFDKE----VLAYT 194 Exiguobacteriu...
jgi:Exig_1285 130 KEVITENYIAAHKILPKK-KSTIF-------IVPSNSDFPTMSESLAGVTGAAYKDAFVLY--LDQTFDKN----VLAYT 195 Exiguobacteriu...
Q5WAV3         87 WQECEAVVARSLGLFTEN-GVKLKvseylftILLGNPKSQSLLLNEGYSGDGGIPGYILCTl-LPNAYTLP----RMKPA 160 Bacillus claus...
Q8DWA7         86 WKRCDQAIQDSLARFS---SFQLPvqdytftALLANPAAPMLQINDGYSGDGGIPGYIFLSl-VPHLDTLN----RVQSA 157 Streptococcus ...
O34458         87 SETAESALRQCIFFAERE-QLRVNakeikfgLYIADPNK--LQLQKGYCGFGGIPGFIHVWi-NPNSYNLP----RIPSI 158 Bacillus subti...
Q0W026         88 HDLMTEAMEKVCDAFQAY-ENRIPlkhlqagLFLLDPAR-MDPADHGYTGFGAIPGYVMVTygEPDAYNLS----KIQPT 161 uncultured met...
Q0W027         88 QGLMSETIARAIEVFKPF-ESRIPlkhiiagLFLLDASR-MDPVDHGYSGYGGIPGYVMLTygELSEYNLS----RLQAA 161 uncultured met...
Q6D2W9         23 NNCLTETYTKASILMNLP-SLDI-----------IVKAGTQVIPEKGHLGYSPEPGIVYITvdPENPSFCSnpnnSLERM 90  Pectobacterium...
Q181L7        165 IAHECNHNIRFQFIEWN-NNITLEEMMINEGLAENFATWMFGEEMLGPWVSRTDIETLNTYIKPIIKSALKETGFQNITS 243 Clostridioides...
WP_012370079  209 VAHEYHHTVAFKSNTHD----SMFNGIMLEGEADMFAAQVYPKGK-SEATEPLLDHTLENLLTQINNHNVDAY------D 277 Exiguobacteriu...
WP_012370163  195 IAHEYHHLVLNDTPELS-RIDTSLDSVIFEGKADAFADQIVTDVS-PPWNIPMDDTTKKHVARLIGNGEADYQ------E 266 Exiguobacteriu...
jgi:Exig_1285 196 IAHEYHHLILHDTPDF--KISSVLKSVIVEGKADAFADRIVKGVS-PPWDVPMDNTTKKHVAGLVNNYETTFN------D 266 Exiguobacteriu...
Q5WAV3        161 LAHEVNHNVRYQYIKWD-HTVTLGELIVSEGLAENFATLLYGEELLGPWVSKTSAETLNRQIKPVLKEQLDVTGFDQIAP 239 Bacillus claus...
Q8DWA7        158 LAHEINHNVRYQFIDWD--GGSLKEMIVAEGLAENFAVQLYGKEKLGPWVSKTDLETLNQLVKPFLREHLDVRGMQKITA 235 Streptococcus ...
O34458        159 IAHEFHHNVRFSYIDFHhGSVSVGDYLVIEGLAESFARELFGTERLGPWVTRFDHEDL-QYSIDVINEVLDVKGFSEVSR 237 Bacillus subti...
Q0W026        162 LAHEAHHSIYSSAVPRNmMSITVGEYMIMEGLAESFATELFGRDRVGYFVEEFDMSQL-PQVKEGMKQALTLSGFDVVRS 240 uncultured met...
Q0W027        162 LAHEVHHNIRLSVMPWDpVNITVEDYLILEGLAESFGTWLYGEDKIGYYISEFPAWKL-PEARQLIKDSLDKKGFGEVRN 240 uncultured met...
Q6D2W9         91 LAHELHHAARWAGPG---YGFSLGEAIVSEGLAGHFTLELFGGEP-EPWEC-LDEVEVQSHILLTRKDWDCTD--YDHNA 163 Pectobacterium...
Q181L7        244 YLYGddIAKmqgyfpvgLPYCAGYACGYYMIKYYLEKTNK-SIIEATLLPYSEI 296 Clostridioides difficile 630
WP_012370079  278 LRYGnyDKD--------IPPLAQYTLGYMIMTDFLQKNPDlPVAKWTEMPTTDI 323 Exiguobacterium sibiricum
WP_012370163  267 ITMGntEKD--------IPLWSRYSLGRDILTHHLKANPDlSIKTWTYEENHAI 312 Exiguobacterium sibiricum
jgi:Exig_1285 267 VTFGneQKD--------IPRWSNYILGRDILNHYLKSNPNlSIKEWTYKDEHEI 312 Exiguobacterium sibiricum 255-15
Q5WAV3        240 YLYGdeLAKlqnftpvgMPYSAGYACGYYLVQYYLKQTGK-SIVEATITPAAQI 292 Bacillus clausii KSM-K16
Q8DWA7        236 YLYGdkIAAmmgqdgvgMPYCAGYACGYYLVKYYLEKTGQ-TIEEATFLPASEI 288 Streptococcus mutans
O34458        238 YMFGdpIANdqgfkpagLSAFAGYAVGYHAVQSFMNQHHI-TISEATRLDAKTI 290 Bacillus subtilis subsp. subtilis str. 168
Q0W026        241 YIFGdrKATkfggkavgMPDHAGYAVGYFIVQDYLTNTGK-TVAEATFVPAVEI 293 uncultured methanogenic archaeon
Q0W027        241 YLYGd-rAPgkakkplgIPAFTGYKIGYEVVQAYLRKTGK-TPVEATFLSAGEI 292 uncultured methanogenic archaeon
Q6D2W9        164 WFYGtsN----------LPRWLGYTLGFNLVTRFLLANPHlRASTLTNVNAEAF 207 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap