Conserved Protein Domain Family
DUF2235

?
pfam09994: DUF2235 
Uncharacterized alpha/beta hydrolase domain (DUF2235)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401826
View PSSM: pfam09994
Aligned: 321 rows
Threshold Bit Score: 67.619
Threshold Setting Gi: 503099032
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KLU90879         65 RKLVLCFDGTGNKFRGD--D-------SDSNILKIFRMLDRTA-SD---------QYHYYQPGIG----Tyvvsnnlsa- 120  Magnaporthi...
WP_013333832     33 ieIGIFFDGIGRHLEQDlrDg------RVSNIGRLYSAFPDQEkDRlgq----afR-RLYLPGLGapyeEnvqenfeatl 101  Halomonas e...
ELS:G432_12230   10 KNIVIFSDGTGQDGGVRpeQ-------RLSNIYKMYRAARPGPdSQidp----rlQVAFYDPGLGtdtsAtgit------ 72   Sphingomona...
WP_015934059      3 KNIVVFSDGTGQDGGVRpeQ-------RVSNVYKMYRVCKVGPeSGidp----aeQVAFYDPGLGtdigAtalt------ 65   Methylobact...
Q11MJ3            3 KNIVIFSDGTGQEGGIRveQ-------RLSNIYKMYRVCRVSPeTNinp----reQVAFYDPGLGtettAtgft------ 65   Chelativora...
WP_013834157      3 KNILIFSDGTGQYGGIRpdQ-------RLSNIYKMYRAMRPGTqTGisp----aeQVAYYDPGLGsgelGgr-------- 63   Novosphingo...
Q12DA6            3 KNIIIFSDGTGQAGGLKpdQ-------NLSNIYKLFRAARPGPeSPinp----aeQIAFYDAGLGtetdEgkip------ 65   Polaromonas...
CCX12339         48 vRLVLCFDGTGDTAEGSfsAaqgsksgTKDSIRTIFDLSKAGPvKDdegk--smyQYVQYFEGVAt--iNvdqkgwg--- 120  Pyronema om...
Q0U1K9           68 KRLVVCVDGTWGCPDGTagSpe----gNISTVYRVYASVKEGYvTDkatgkrwdqQ-RVYFNGLG--------------- 127  Parastagono...
XP_007929914     41 RRFVICVDGASYKPDANs---------iPTNIYRIYTSIKNGKcVDrdtgityhqE-PLYYAGIGgad------------ 98   Pseudocerco...
KLU90879        121 -----------htsmrarfkSWMTKAK---DS-----AIGSSFDQHVVGGYRFL-----------MRFY-------SP-- 161  Magnaporthi...
WP_013333832    102 rrasseavdgveghlrggvtGAAKEAVfntDGgawweVFGRSWKASLTKPWEWVksardaairtgAEVF-------SPir 174  Halomonas e...
ELS:G432_12230   73 -----------------sirRGITKLL---SS-----VTGRGITTNIADCYEFI-----------VNHY-------TP-- 107  Sphingomona...
WP_015934059     66 -----------------apvRFVQKMA---AS-----VSGRGITTNIADCYRFI-----------IDHY-------EP-- 100  Methylobact...
Q11MJ3           66 -----------------svvRWVQKTL---AS-----VSGRGITTNIVDCYEFL-----------INHY-------EP-- 100  Chelativora...
WP_013834157     64 ----------------------lRNIL---AS-----AFGTGISENIVDCYEAI-----------IKNY-------ED-- 93   Novosphingo...
Q12DA6           66 ----------------frpvQKFRKIW---SA-----ATGTGISRNIADCYEAI-----------LKHY-------EP-- 101  Polaromonas...
CCX12339        121 -----------------------iqaqalfDG-----ATGNGYLDILRNGYKVC-----------CQQLqhagpgnGP-- 159  Pyronema om...
Q0U1K9          128 --------------------NKLNALKnlhSG-----AFGSGLPDEIRKVYEYC-----------CRETd------GP-- 163  Parastagono...
XP_007929914     99 ------------------dvLSKDRLQ---AG-----VLGNPYQDQIRNIYEKC-----------CELS-------GP-- 132  Pseudocerco...
KLU90879        162 -----------G------------D-----------------EIYIFGFSRGAYIARFLA-EMLDYVGLL-----S--HG 193  Magnaporthi...
WP_013333832    175 dhpitanllmsGaatrqsaaieqfQgavsdvagnsqmplgtiRVSVFGFDFGAALAKAFVrELLEEVCE---------QE 245  Halomonas e...
ELS:G432_12230  108 -----------G------------D-----------------RIWLFGFSRGAYTARCIA-NVLMLCGV------PtkVP 140  Sphingomona...
WP_015934059    101 -----------G------------D-----------------RIYLIGFSRGAYTVRCVA-NLLMYCGV------PtkGA 133  Methylobact...
Q11MJ3          101 -----------G------------D-----------------RIFLFGFSRGAYTVRSVA-NLLMLCGI------PsrDG 133  Chelativora...
WP_013834157     94 -----------G------------D-----------------RVFIFGFSRGAYTARCIA-NVMNLCGV------PrsGE 126  Novosphingo...
Q12DA6          102 -----------G------------D-----------------RVFLFGFSRGAYTARCVG-GVMSLCGV------PthAA 134  Polaromonas...
CCX12339        160 ------------------------N-----------------EIFIYGFSRGAFISRALT-SFLQHVGIIkaeflDknED 197  Pyronema om...
Q0U1K9          164 -----------D------------D-----------------EIYFFGFSRGAFTVRAVA-NLLCYMHV---------PK 193  Parastagono...
XP_007929914    133 -----------H------------D-----------------EAVFFGFSRGAYVVRAVA-GLLHRFGAL---------- 161  Pseudocerco...
KLU90879        194 NE----EMVAF------------AWKAFAQWQC-------RRGKLREESRKKteel----------yeflKGFRETFSRP 240  Magnaporthi...
WP_013333832    246 GE---------------------HYR-YEDAEVq---------------------------------------------- 257  Halomonas e...
ELS:G432_12230  141 -E----GELPRfrlrvreisgraVIRVYEHGAGh------DRAKYEEERDELarr------------frhDFGSDAGGEA 197  Sphingomona...
WP_015934059    134 -G----GPLLRfckmtrdiareaVETVLEHGAGh------PRKDFDAERHELarrfr---------akygSDHDDGDGKS 193  Methylobact...
Q11MJ3          134 -D----QPLARfrkavrdiassaVHNVLEHGAGh------PRAKFEDERLELarrfr--------arygaDHESGEPHRS 194  Chelativora...
WP_013834157    127 NG----NPLPAggialrkiaeeaVYKVYEHGSGh------SRAEYETEREELarrfre-------kygsrGTGYSGEAQG 189  Novosphingo...
Q12DA6          135 DG----SPLPRfgkglrriadeaVSQVYEHGSGs------NKPERKEERLEKarrf-----------rekYGSQNDAGQS 193  Polaromonas...
CCX12339        198 EDtlfqEKFRQllerymkltskgMFTK-------------ATPTDSASE------------------------LLPFCIP 240  Pyronema om...
Q0U1K9          194 GS----QKFSKeefterykelleLYPGVRASDRniwgqihSHFNR--------------------------------STR 237  Parastagono...
XP_007929914    162 ---------------------------ISAGSPefgrnykKLLKDLGHPSLSstsnlslahvradsvssiSTITTQELRP 214  Pseudocerco...
KLU90879        241 VRRIRFLGLFDTVNS----VPRFETAWMERA------------------------------------------------- 267  Magnaporthi...
WP_013333832    258 ---IVFAGLFDCVDRthpeLGPV--------------------------------------------------------- 277  Halomonas e...
ELS:G432_12230  198 NVAPYFVGVFDTVAS----LGAKGPLRIALAalvallvaaaaatlagvahwafgirwtwsf-------------laaaav 260  Sphingomona...
WP_015934059    194 NVEPYFIGTFDTVAA----LGVAGPKRTLIKaglaaavviplaiviavtsavvggisylfdgpfwqadlitsgvlvvasa 269  Methylobact...
Q11MJ3          195 NASPYFIGVFDTVAA----LGVKGPLAIGIKiflaagaallaaalafvpavvvagvlsffgfafwc---smlalvglaav 267  Chelativora...
WP_013834157    190 NVAPAFVGVFDTVAA----LGTVIVRRILGLlfvvslalvasawgfdwaepwkllah--------------------vpa 245  Novosphingo...
Q12DA6          194 NVVPYFIGVFDTVAA----LGAPGPRRLLMGlslvafvglttaaaagivslmpwfsfwpa--------------fsafta 255  Polaromonas...
CCX12339        241 SPRVRVLGAFDTVKT-------------VIP------------------------------------------------- 258  Pyronema om...
Q0U1K9          238 PPTIRFIGAFDTVKK----------------------------------------------------------------- 252  Parastagono...
XP_007929914    215 SPNIRFLGVFDTIKA----------------------------------------------------------------- 229  Pseudocerco...
KLU90879        268 -----------------------VSKFPYT-A-----------RTSAKVIRHAVSIDERRAKFRQDLIYQs--kHESmer 310  Magnaporthi...
WP_013333832    278 ---------------------------DWFhPltpvlddggplHPGCRRALHLIAAHERR--------------FYRrcr 316  Halomonas e...
ELS:G432_12230  261 iggwtlwgylrtalkimwpplpgRRWPSMHlAqwsgrnfdrllSRSVLYARHAIAIDENRADFPRLKWGWgkgvERPpev 340  Sphingomona...
WP_015934059    270 avafavrrhlvaaktktitdwpsPGEKRSHvAewkgenfdrllSAQVGYARAAIAIDERRKDFDRVKWGPtetpPPRap- 348  Methylobact...
Q11MJ3          268 aggvlitwqqrrsirkvirdfphPGDKSSHlAewkgehfdrllSRFVGYARSANAIDETREDFARVGWG-----PTRemp 342  Chelativora...
WP_013834157    246 gfflisllwaskkqfkyirnppqGGRLSWHfAawnlknydrflDSSVGYARHALSIDENRKRFPRVGWGLrkdtDEQdr- 324  Novosphingo...
Q12DA6          256 aialallagyvntsvktirdfpkKGNFSWHiAawrfrfydnslNTRVRYARHALAIDETRKDFARVPWATlgewPARpg- 334  Polaromonas...
CCX12339        259 -----------------------LPFHNYFkErianidfqmdaPGIVDHFRHALALNEARPLFNPDLWKSeselSN---- 311  Pyronema om...
Q0U1K9          253 ----------------------------FTdNglyd----vmpHSQIHHYRHALALNEERDEFKPETMMPdndaCSP--- 297  Parastagono...
XP_007929914    230 -----------------------------VdDshfd----isfNSSIKHFRHALALHEDRRALQPEEVHP----PEFygt 272  Pseudocerco...
KLU90879        311 kkaaaeakakehgglhqarhmihelhekyrvhhthhrlqqtpvfvdpkpevegqgqghgektngksagapqpaqdrgrrq 390  Magnaporthi...
WP_013333832    317 p------------------------------------------------------------------------------- 317  Halomonas e...
ELS:G432_12230      --------------------------------------------------------------------------------      Sphingomona...
WP_015934059        --------------------------------------------------------------------------------      Methylobact...
Q11MJ3          343 e------------------------------------------------------------------------------- 343  Chelativora...
WP_013834157        --------------------------------------------------------------------------------      Novosphingo...
Q12DA6              --------------------------------------------------------------------------------      Polaromonas...
CCX12339            --------------------------------------------------------------------------------      Pyronema om...
Q0U1K9              --------------------------------------------------------------------------------      Parastagono...
XP_007929914    273 e------------------------------------------------------------------------------- 273  Pseudocerco...
KLU90879        391 srqaaaahppprasldhaeryrahhsrsksrathrtrdssvaaavaarrlsgaghhaghehpdrlevpggdnddddedrd 470  Magnaporthi...
WP_013333832        --------------------------------------------------------------------------------      Halomonas e...
ELS:G432_12230      --------------------------------------------------------------------------------      Sphingomona...
WP_015934059        --------------------------------------------------------------------------------      Methylobact...
Q11MJ3              --------------------------------------------------------------------------------      Chelativora...
WP_013834157        --------------------------------------------------------------------------------      Novosphingo...
Q12DA6              --------------------------------------------------------------------------------      Polaromonas...
CCX12339            --------------------------------------------------------------------------------      Pyronema om...
Q0U1K9              --------------------------------------------------------------------------------      Parastagono...
XP_007929914        --------------------------------------------------------------------------------      Pseudocerco...
KLU90879        471 lahmpeasdvddgfsssdedDQDIDEVWFSGGHGDVGGGW-DIEpgg-ksASHVPLAWMVRE 530  Magnaporthiopsis poae ATCC 64411
WP_013333832    318 ----------------lgtlQADWREILQPGISEDIGGGLkPDEqkvsaeLSLAALHRMYRS 363  Halomonas elongata
ELS:G432_12230  341 -----------------egeAKPFIQLWFAGNHSDIGGSYpESEs----rLSDISLQWMLEE 381  Sphingomonas sp. MM-1
WP_015934059    349 ------------------gaPDQFRQFWFAGNHSDIGGSYdETEs----rLSDIALKWMLEQ 388  Methylobacterium nodulans
Q11MJ3          344 ----------------erngVRTFKQLWFAGNHSDIGGSYpESEs----rLSDIALQWMIEE 385  Chelativorans sp. BNC1
WP_013834157    325 ------------------gdLAWLKQVWFAGNHSDIGGSYpENEs----rLSDISLQWMLDE 364  Novosphingobium sp. PP1Y
Q12DA6          335 -------------------ePEWLQQVWFAGNHSDIGGSYaEDEs----rLSDITLQWMAEQ 373  Polaromonas sp. JS666
CCX12339        312 ---------------------SSYLEAWFFGYHHDIGGGDaVQG------LALWPLQWILHa 346  Pyronema omphalodes CBS 100304
Q0U1K9          298 --------------------GRSGLQAWFIGTHRDLGGANsKDG------LSLYPLQWVLSE 333  Parastagonospora nodorum SN15
XP_007929914    274 ----------------lrhfGRSFVQALFIGSHGDM-GGVsEKAg-----LGLYPLQWMILE 313  Pseudocercospora fijiensis CI...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap