Conserved Protein Domain Family
DUF2231

?
pfam09990: DUF2231 
Predicted membrane protein (DUF2231)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401824
View PSSM: pfam09990
Aligned: 34 rows
Threshold Bit Score: 56.4554
Threshold Setting Gi: 81770966
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7NMM7          54 LFDIGWWNLVAAAVISFVTVAFGMFETLLIeISPaeanilsrwgfSLEQTRLLHAVGGVTMLAVIVLmsvwrgfqRYFWR 133 Gloeobacter v...
P74613          45 FFEVAWWNWLTAAIAIFFAVIFGEFEAALAmPYP-----------AAQPALDWHTVNGWSLSAILAGlt----awRGVLR 109 Synechocystis...
Q8YTI8          49 LFEVSWWNMFVATIAIFVAIIFGQFEAGLAkPYE-----------VAKSVLNLHTLLGWSLSGIIAAlt----awRYVIR 113 Nostoc sp. PC...
Q8KX05          50 LYEVSWWNMFVATVSIFIAIIFGQIEAGLAiAYD-----------AVEPVLNLHTIIGWSLSGIIAAlt----gwRYVIR 114 Synechococcus...
wustl:cce_4107  49 LYEVSWWNMLIATVSIFVAIIFGQYEAGLAqPYE-----------VVEPVLNLHTLIGWSLSGIIAGit----gwRYVIR 113 Crocosphaera ...
Q7NMM8          51 FHNVGWYNLVVACAAVIGAIIFGQIEAGLAhQSN-----------AMQPVLAWHTIIGWSLGALILIma----awRGVAR 115 Gloeobacter v...
Q31RT7          48 lLNAGWWNLVVAAIAIFFAILFGQFEIGLAqPSQ-----------AAQPTINRHLAVGWLLLLLLPNla----lwQGIER 112 Synechococcus...
Q119R3          68 FFDVGWYNMLASSIITFFTVAAGFYEIMLAtPSPelks---vwglGAMDTMLWHGIGGVLLLAMIIGmtiwrgfqRYIWS 144 Trichodesmium...
AHJ26452        68 FFDVGWYNMIGATIITIFTVAAGFYEMLLAtPPAdvks---awgmQAMETMLWHGVGGVFLLALISGmtiwrgwqRFVWS 144 Nodularia spu...
Q8YTI7          68 FFDVGWYNMVGSTVITFFTVAAGFYEMFLAaPSAdiks---twglQAMQTMLWHGVGGVFLLGLIAVmtlwrawqRYVWS 144 Nostoc sp. PC...
Q7NMM7         134 KHEERQVQWGYVFTGVIAVGLLYVQGELGAQMANDFGVH 172 Gloeobacter violaceus
P74613         110 VRNPLKTSLPFLMLATVFMVLVCIQIFLGSLVDWVYGLH 148 Synechocystis sp. PCC 6803
Q8YTI8         114 LRNPLKIPFHYLVAGLVLTMIVGVQVYLGDQLVWIYGLH 152 Nostoc sp. PCC 7120
Q8KX05         115 SKNPETLPMSYLGMGAILTGIVFFQVYLGDKLVWVYGLH 153 Synechococcus sp. PCC 7002
wustl:cce_4107 114 SRNPEQLPIPYLGLGLVLVAIVGVQVYLGDELVWVYGLH 152 Crocosphaera subtropica ATCC 51142
Q7NMM8         116 YRDPNRLNPAYLGLSLLVVGTVFYQVFLGTQLVWTYGIH 154 Gloeobacter violaceus
Q31RT7         113 SRDRTRISKGVLAFKAIVVVLVCYQFLLGTTMYWVYGIH 151 Synechococcus elongatus PCC 7942
Q119R3         145 QDKLLQVQWSYLAVGLVILFVMYVHGTLGAQLAAEFGVH 183 Trichodesmium erythraeum IMS101
AHJ26452       145 EDADQEVQWSYLATGMAVMLILYVHGTLGAQMAAEFGIH 183 Nodularia spumigena CCY9414
Q8YTI7         145 VGEVTQVQWSYLAAGVAIMFIMYLHGTLGAQLAAEFGVH 183 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap