Conserved Protein Domain Family
TPR_21

?
pfam09976: TPR_21 
Tetratricopeptide repeat-like domain
This family resembles a single unit of a TPR repeat.
Statistics
?
PSSM-Id: 401812
View PSSM: pfam09976
Aligned: 64 rows
Threshold Bit Score: 159.274
Threshold Setting Gi: 358635850
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBL45763       19 KDWWKDYGNTVLIGFGLALAILFGWKAWQSSAKDKSDTAATAYMQMQDaaqamrqQPPvasaadgsKVETPqhaTFLHMA 98  gamma proteoba...
jgi:Rmag_0672  16 KRWIKENTLQIVVGVALGLGGIFGFDAYKNYQHSQLIKARSIYLTLVS------------------NPNDT------QAY 71  Candidatus Rut...
WP_013203390   15 RGFFAQNGKALVIGVIIGIGALAGWRYWSSHEDGSSRETSAAYQQVSG-------ALD--------SSKPE----TLAAA 75  Erwinia
Q2NS42         15 RRFFVDNGKALAIGVVLGVGALVGWRYWHNHHNDAMMAASSAWQPVNA-------GLS--------GQAAQ---PQLDAA 76  Sodalis glossi...
Q5QYB1         13 KEFWKEHGKGIVAGVVIGFGLFYGWRYYDQHTLETQQRASANYEQLTA-------ELS--------EGSEN----AVLEA 73  Idiomarina loi...
WP_012729117   15 KSWWQENGKSIIAGVVIGFVGLFGWRYYNDYTRQQSESSAAGYQQVMQ-------NLS--------EQHEK----AFAEV 75  Tolumonas auensis
Q2SDW6         15 KNWWKENGNALLIGIGLALAAIFGWKAYNQNELQKKEEASQMYQELVQaagaaqmADD--------EKSQA---NITFLA 83  Hahella chejue...
WP_012069072   15 KSWWKKNGVMLVVAIAVAVGGYFGWQAWKTSQTNYTSEASALYQNLVQ-------ASAdl----sdENNQK---TVTFIA 80  Marinomonas sp...
WP_013660405   15 KTWWKKNGTALILAVAVGVGGYFGFQAWKTNEATHISEASSLYQTLIE-------AASdl----dtEKNQK---DVAALA 80  Marinomonas me...
WP_013033412   17 KQWWRENARAVLVGIIIGLLALFGLRGWTEYKQNRIREASSLYQQILT------------------AKAQEagaEIYNSA 78  Nitrosococcus ...
CBL45763       99 EQIKKDYPDSGYAIMAALQLARDKVDNNDAAAAEVELRWALDHKPNPALTTIINMRLARVLAMKGDIDGGLKVLEGIQPE 178 gamma proteoba...
jgi:Rmag_0672  72 EQLKNNHASSGYLDQATLILAKNAVANKNYMQALEYL-APLSDTSNISIAKVVNMRIASLYLEMGHYKQALGALNTVPNS 150 Candidatus Rut...
WP_013203390   76 AKFASENSNT-YGALASLDVAKRYADGNQLDQAAAQLQSGLKDTKDANLQAVLNLRLARIQLQQKKPDEAVKTLDLIKGD 154 Erwinia
Q2NS42         77 QHFADANDNN-YGALTSMGLARQFAERGDFPAAEKQLQKALGQTREANLQSLINLRLARVQLQQKNVDGALKTLDGVKDQ 155 Sodalis glossi...
Q5QYB1         74 QEFVSENPKNVYAQLVALQLAQHSVERADLATAVTALQSVVDSAEDENMSALASIRLARVLIAQEQLDAALSLVKKPLPE 153 Idiomarina loi...
WP_012729117   76 GQFIAAHKDT-YGDLAALQLAAEAVKANKPELAAEQLRRVADQASDEEFKPVAGIRLARVLIAMNKPADALKVLDSVTAG 154 Tolumonas auensis
Q2SDW6         84 TELQSKFPGTTYALYAKLYEAQQAVAKKDFAGAETALKAVASETEDEALKRVVSLRLARVLAAQQKFDDALAALKAQKGD 163 Hahella chejue...
WP_012069072   81 KQLADDYGDTGYAMFGQLFLARVDAENGKYDEAIKALDDAIAKTKDVSFVAIANLRVARLMLQKEDYAGAMARVEKVSEE 160 Marinomonas sp...
WP_013660405   81 AQLNEEYSDTGYAMFAELFVAELEVSKGNYDKAITALEAAVSGTEDQSFQTIATIRIARLLAEKEDFDAALSKLESVTQS 160 Marinomonas me...
WP_013033412   79 ERLVQDYSDTPYGLFSVLMLAKEDQARGDAEAAAERFKNALEHTQNTGLRRVIYLRLARLLLAEGNPEEALTTLAEIEPG 158 Nitrosococcus ...
CBL45763      179 AQRAEYEEVKGDLYYAKGDMTKAREAYQASMNAGGGSAs-qAILKTKLDDLAV 230 gamma proteobacterium HdN1
jgi:Rmag_0672 151 AFDGLYNQLKGDIYLADKQIDNAKKHYKLALNQISKDSklqNLIKIKLNDLN- 202 Candidatus Ruthia magnifica str. Cm (Caly...
WP_013203390  155 GWTAIVADVRGEALLSKGDTKGAHDAWSKGIDSDASPAl-kEMLQMKMNNLPG 206 Erwinia
Q2NS42        156 GWTALAEDTRGDAQVIKGDQQAARTAYEKALQSGAPQ----ALVRMKLNNLSS 204 Sodalis glossinidius str. 'morsitans'
Q5QYB1        154 AYAGFAAELEGDILAEQGNTEEARAAYERALQAGESLT---PALQMKLNSLVK 203 Idiomarina loihiensis
WP_012729117  155 QYKAAVAEVRGDALLASSQPDKAREAYTAAMQASKNGVn--PVLQMKLDDLSV 205 Tolumonas auensis
Q2SDW6        164 VFYSHFQELAGDILKMKGSRAEAKAAYEQALADAKEHElptELLQIKLNDLAD 216 Hahella chejuensis KCTC 2396
WP_012069072  161 EFAAQQQELIGDILISQGKRDDARVAYQKASEALGVGVn-hPLLDIKLKDLVK 212 Marinomonas sp. MWYL1
WP_013660405  161 EFSVQKNELKGDIYVRQGKRDDARTAYEQAKQDLKAGQn-hPLLDIKLGDLAK 212 Marinomonas mediterranea
WP_013033412  159 SFASAYAELRGDAHVELGQLPEARQAYQEALLDLGPGEprrQILSMKLDNIAQ 211 Nitrosococcus halophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap