Conserved Protein Domain Family
DUF2198

?
pfam09964: DUF2198 
Uncharacterized protein conserved in bacteria (DUF2198)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401803
View PSSM: pfam09964
Aligned: 12 rows
Threshold Bit Score: 71.1594
Threshold Setting Gi: 81785626
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y4F4                  3 QIISALIFPCLLVILFARITYNRYVGLLLMVILIAASAKLGYTSSMWLIIIDAFSMTIGFVLATYMLRRLKK 74  Listeria monoc...
PRJNA212797:N288_21805  4 KYLSALLLPGLLVMFFTRVTYNHVIGLILTVALIAASVYKGYTDSWGLIVVDAFSLTAGFWYAQIMKQRAKK 75  Bacillus infan...
WP_015595671            4 KFLSALLLPGMVVVLFARVTYSHIIGLVLTVALIAASVYKGYTNTWWLIIVDAFSLTVGFWYSTAMIEKTRK 75  Bacillus sp. 1...
WP_014095840            4 QLVVAAVFPCFLVIFFSRVTFNQVIGLILTVALIVASVYKGYTRTWPVYIVDAASLTIGFYFANTMIRKAKm 75  Bacillus coagu...
Q5HQX2                  3 WYVCAAFFPCILVVLFSVVTRSKWIGTLVTLVIIGASVYKGFFHNEWIIFIDVTSLLAGYLIIDQLEFHKNQ 74  Staphylococcus...
Q2G051                  3 WYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLAGYLIIDQLEFHKHQ 74  Staphylococcus...
Q9K6X7                  3 dVFLALVLPILLMVGVTRVTF-HLLGATIVSFMVLFAWFRLHEKPWYVIAIALISLLAGWHFGKRVLKKKpg 73  Bacillus halod...
WP_009362318            2 WFVLALIVPALLVIFFTRVTYNHYVGTLLTVALLVASYVKGYTDQLYEIVADLASLIVGFLYAKQMVEKQKR 73  Anoxybacillus
Q5KVB4                  2 WFLAALIIPCLLVLLFARVTYNRYIAVLLTTALLVASYLKGYTDELHEIVADIASTIAGFLWAGRMLDYLKQ 73  Geobacillus ka...
WP_015865054            2 WFIVSLIVPCLLVLLFTRVTYNHYIGTLLTIALLVASYFKGYTDELHEILADIVSTTVGFLYAKKMVKQLKK 73  Geobacillus
Q65ED7                  4 KAVFALIFPFILVLFFTRVTYNHYVGIALTAALLFASYLKGYTETFFIVGLDIASLVAGSLYAAKKAGEKKE 75  Bacillus liche...
ABV63804                4 KAIFALVFPFLLVILFSKVTYNHYVGIALTAALLFASYMKGYTETYFIVGLDIISLVAGALYMAKKEIEKRE 75  Bacillus pumil...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap