Conserved Protein Domain Family
DUF2184

?
pfam09950: DUF2184 
Uncharacterized protein conserved in bacteria (DUF2184)
This domain, found in various hypothetical bacterial proteins, has no known function.
Statistics
?
PSSM-Id: 401793
View PSSM: pfam09950
Aligned: 28 rows
Threshold Bit Score: 198.679
Threshold Setting Gi: 273809563
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Daci_4095  60 GRA-NWQ-SGYAKDIPLADVNQDMQTKTFQLAAIGYQWNLEEVNTTMAFpGASLSDRRARAARLAYMKFMFDLTLKGSP- 136 Delftia acidov...
Q7N327         62 KD--GII-GNKTNSLKTIDSDIEWHKAPVGQWGKSATWTQQELEKIARL-NINLQTKKQDDLYANATATIQYAGYVGHEg 137 Photorhabdus l...
CDC49780       89 gsgdGIVhAGGSNGIPMVQADFSKGTYKAHMIAAGTRVMWVDMQRGNMT-GRNLDSLLRDGLRMAYDKHLEENTYVGFK- 166 Clostridium sp...
CDA50593       26 NDL-SIV-GTASNTIPVMQVSTEKNLYKVFTWMHMMRINFVDMAKAKQI-GRSLEDMLNKGIRLNYNKSLDMNVYKGFE- 101 Dialister sp. ...
WP_006192081   82 GQA-DGV-GGIQNAVRRIQADLSKDLYKVLPYEVSMSIKIQDQLRGAVT-GRSIEDIYNDGIRLDYDKYMDINTYLGQE- 157 Selenomonas sp...
jgi:Xaut_3633  99 psglSWA-SLEATARPRAVLDIGKVVSPLHLWSMDVAYTLPELESARLT-GRPIDTQMLSALNRKNQMDTDQVVYIGDS- 175 Xanthobacter a...
WP_015875594  108 pnglNWI-SNEGNAIAGPSVDIGKTPQPMRLWGAEVKYTVPELVKSQKL-GMPIDAQKVDAMNLKRNMDIDQIVYFGDP- 184 Burkholderia g...
WP_014402917   86 ptgkAWV-GKDASAITGLGLDIGKTMHPLSLWAMQIGWTIPELASAQQL-GRPVDQQKFAGMNLKHQMDIDEQVYIGDT- 162 Frateuria aura...
Q2NRY5         73 ADGeSWI-SHSTNVIAGIDLDINKTTLPLTPWSRQLSWTVFELASAMQL-GRPVDSQKLDAMNQVYQLNVDRQVYVGSK- 149 Sodalis glossi...
Q32EP9         69 pngkNWV-GKDSTAIAGVNVDIGKSGNPLNLWGMELGWTVIELQAAQQV-GRPIDTQKYDGMQLKWQMDNDEQVYVGDS- 145 Shigella dysen...
jgi:Daci_4095 137 EKGMGGLINY-NGVVVANAPADgtggstlwvnaagvgqKTPAQIV-RDINIALQ---GISLAtfet--elaDTILLPVEA 209 Delftia acidov...
Q7N327        138 VKGQEGLLTG-SKVQLIAEVTGk---------------SIKDMSAeEFINMVLNaynVAWAKsgyr--iqpTHVAIDASD 199 Photorhabdus l...
CDC49780      167 RYGTTGLLNN-PDVVVLDAASNgadsas-----tkfkdKTPDMIL-KDINDAIL---YAWSQceydrdavpNHIIMPYEQ 236 Clostridium sp...
CDA50593      102 KLGTTGLVND-PNVVVATADNGasgka-------twkdKTPDEIL-DDINQAIT---AAWVAseydldgmpNHILIPPQQ 169 Dialister sp. ...
WP_006192081  158 AYGTTGLLND-KQITATAVTAGasgqt-------dwahKTPTEIL-NDIDEAII---AGWTGaqydnsaipNHILIDPAN 225 Selenomonas sp...
jgi:Xaut_3633 176 SIGTTGLLNS-ASVTNVSNVAAgasss------mawtsKTADEIR-KDVNELLI---SVWAAsgyv--appTKLALSPTA 242 Xanthobacter a...
WP_015875594  185 QIGFTGLVNSnSAVASVTNVANgasgt------pqwttKTPDEIL-RDVNEILT---SAWQAsgwk--vkpNRLMLPPAQ 252 Burkholderia g...
WP_014402917  163 VLGLEGLVNS-SAVTTTNVVNGasgsp-------lwssKTPKEIL-ADFNAILN---LAWEAsaya--vcpTKVLIAPAK 228 Frateuria aura...
Q2NRY5        150 LLSVQGLLNQ-ASVKRSKagkp-------------wkqSTADEIR-AAIDAGLT---TAWKQtgra--vvpDKMLVSPDE 209 Sodalis glossi...
Q32EP9        146 ALNLKGLVTL-DGVPVNNaakt-------------watSTPDEIR-ASINQVLS---DAWAAsgys--vvpRDLLILPEQ 205 Shigella dysen...
jgi:Daci_4095 210 FNYIAATPYSATT---METILsfvm------rtnLYTMQTGRPLTIRTVRElGTGAANGTT-------GRMVAYKNDGEY 273 Delftia acidov...
Q7N327        200 FM-LAMQKFDTNSvivGVDLLpvsamdrimaalrKASNNDSFSITFVKVPSnFAKNIVKGK-------TRLAIYTYSEDY 271 Photorhabdus l...
CDC49780      237 FNYLATTKVTDLA---EKTILtfll------ennVA-KQNGADLFIGATSW-CKGAGDESE-------DRMVVYCNREKY 298 Clostridium sp...
CDA50593      170 YTLLVTRKVSEAG---NCSLLeylm------nnnIA-KNQGRSISIYPSRW-CIKAGAGQT-------DRMVAYVNDEDK 231 Dialister sp. ...
WP_006192081  226 FAYINRTMVSVNGyptPVSIMqylv------dhnIA-KAKGVDLVIAECRF-CIGAGIGKK-------NRMVAYVNQRRF 290 Selenomonas sp...
jgi:Xaut_3633 243 FGYISTTIASSAA---NATILtflk------ennILTAEKGIPLDIVSVKW-LDKANRSGAs-----yDRMVAYSQQPEY 307 Xanthobacter a...
WP_015875594  253 LGWVASQVISSAG---NKSILtyll------ennIC-TQQGVKLEILPLKW-LIGAGTGGTpgtlgtvDRMVAYNNDKKY 321 Burkholderia g...
WP_014402917  229 YSIL-TQPVSEAG---NISILeyvr------tncISHNVNGRPLDIQPVKW-LAGRGTSGT-------DRMVAYTQEMDR 290 Frateuria aura...
Q2NRY5        210 YALLVSTIVSSAG---NRSLLdyln------entIAFKQNGKPLDIQPVKW-LEKGDEFTA-------NRAVLYSQDRKY 272 Sodalis glossi...
Q32EP9        206 FALLSSIIVSSAG---NQSLLtylq------tntISYHQNGVPLNIRAVKW-LKGRGVGNK-------DRMVAYTNDKKY 268 Shigella dysen...
jgi:Daci_4095 274 VKLHLPMPHRF-LPVYqDGPLNYAVPGIFRTGGVELLTTVAMRYIDqI 320 Delftia acidovorans SPH-1
Q7N327        272 IEMKVHMPELL-AVRQ-RDLLTFECGYRSAFGGAMWKQPKSAVYVDyk 317 Photorhabdus laumondii subsp. laumondii
CDC49780      299 LAMDELVPLTRaMTGPnTAEFCYDTAYAGNLSEVEVFYDQTMVYVDgI 346 Clostridium sp. CAG:58
CDA50593      232 VNFDITVPITRaMSSPnLSAAAYDTLYAAQIGQVKFNYYQPVRYIDgI 279 Dialister sp. CAG:486
WP_006192081  291 VGMDVPVPMSRvMTQPnVNTASYDSLYMANVGQVKIHYFEPFIYRDgI 338 Selenomonas sputigena
jgi:Xaut_3633 308 VRFPF-VPLIP-ATTQ-YEGIWVKVPYYGKLGQVEVVYPEVIGYRDgI 352 Xanthobacter autotrophicus Py2
WP_015875594  322 VQYPM-TDLQR-TPLE-YRSLFQITTYWSRLGQIEWRYGTTGAYRDgI 366 Burkholderia glumae
WP_014402917  291 VRFPY-VPLQR-TPLE-YRDLRQLVTYFGRLGAVEFVYPETLAYADgy 335 Frateuria aurantia
Q2NRY5        273 VQFPL-VPLQR-TPME-YRDLRQIVTYYSKVGAVELRYSDTMHYVDgI 317 Sodalis glossinidius str. 'morsitans'
Q32EP9        269 VRYPL-VPLQS-VPVQ-YRGLYQIVTYYGKLGAVEPVYKETISYVDgI 313 Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap