Conserved Protein Domain Family
DUF2138

?
pfam09909: DUF2138 
Uncharacterized protein conserved in bacteria (DUF2138)
This domain, found in various hypothetical prokaryotic proteins, has no known function.
Statistics
?
PSSM-Id: 370747
View PSSM: pfam09909
Aligned: 8 rows
Threshold Bit Score: 645.247
Threshold Setting Gi: 119668766
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rpic_3312    6 KQIAVGAVALVVAGTavvqmvw-----------------hpfgrtrALHARQVQLDLTYPDALIDSQSLSQLPRDVLRVP 68  Ralstonia pic...
Q4K5A9          14 PVLVMGLCLVAAAVTgvgck----------------------pktpVAELAGDKLGLSRPDGLLETHSLAQLPKDLLAVP 71  Pseudomonas p...
PNU:H681_05260  27 liaigvvAAILVAGGlalafglipa-----------fhsvpvgtleAPETPEALLDLKRPDALIESASLSQLPRAVLEVP 95  Pseudomonas s...
Q9HVT0          27 PVLGIVAA-LAAGGVlawqmgwlerlgggrpaeedlgqpigaqapaAADAPRAYRDLRKPDALIESVSLSRLPKEILEVP 105 Pseudomonas a...
CAL92679        10 RKLLFGVIVLALVVGavalfwlk---------------------rfdghvnALALDLARPDALIRTRSLARLPADLLRVP 68  Azoarcus sp. ...
Q13R71           6 KKIAILVVGLLVVAGviiqavw-----------------rpfahrkAAGNGEIVLDIHHPDAVIDSEALSRLPRDILSVP 68  Paraburkholde...
P17994          14 GLVGFGAIALLSAGVwalqyags---------------gpektlspLVVHNNLQIDLNEPDLFLDSDSLSQLPKDLLTIP 78  Escherichia c...
AHG21338        20 gFWVVGVILIISAAAwgiqhflla-------------pqqssppqeLVWHNNLQIDLHHPDVLIESESLGRLPKDLLAIP 86  Chania multit...
jgi:Rpic_3312   69 LLRDVLTEDFVAYYEGNDDRLSVAGALRRLAYEQKLDLAETVLKHVFDEPARVMLWRGPDDKLRYWVLSMQRNGLAKALE 148 Ralstonia pic...
Q4K5A9          72 FLKETLTEDFVFYYQTHADRLGLIGSLRRIIYEHDLKLQDNLIEQLFDQPADVALWRGADGRLKDFLLVMDRGGLAKLLE 151 Pseudomonas p...
PNU:H681_05260  96 LLRDVLTEDFVFYYENNGDRLGLTGTLRRIVYEHDLTLKDSLIEELLDQPAQVALWRGPDGRLRDFLVVLRRGGLAKLLE 175 Pseudomonas s...
Q9HVT0         106 LLRDTLTEDFVFYYENNGDRLGLTGTLRRIIYEHDLTLKDSLVEELLDQPAQVALWRGADGRLRDFVVVLKRGGLARVLE 185 Pseudomonas a...
CAL92679        69 LARDVLTEDFVDYYERHEQRLALSGTLRRIAFEHRLSLPERVLESVFDEPAEVALWRGADGSLKHFVVAMTRNGLARALQ 148 Azoarcus sp. ...
Q13R71          69 LLRDVLTQDFVDYYESDNTRLSAEGALRRLAFEHQLDWRDELIRRVFDEPAHVLLWRSPDGRLGYWVMSMHRNGFAKLLQ 148 Paraburkholde...
P17994          79 FLHDVLSEDFVFYYQNHADRLGIEGSIRRIVYEHDLTLKDKLFSSLLDQPAQAALWHDKQGHLSHYMVLIQRSGLSKLLE 158 Escherichia c...
AHG21338        87 FLRDTLTEDLVFYYQNNADRLGIAGSLRRIVYEHELTLRDNLLEMLIDQPADIALWHDERGRLSHFMAVIKLSGLARLLE 166 Chania multit...
jgi:Rpic_3312  149 AVATVATSDAQLSK--VADG-LGDSGAPVYALRLSATRSILIASKGDRLIALSEPGMLLDKDGK------------PISK 213 Ralstonia pic...
Q4K5A9         152 PLAKVALDDTQLSK--LADLkVGGDAVTLYQLNYNASRSLAFASHGDKLVVLSNPAKLYDPATGad--------deHGAV 221 Pseudomonas p...
PNU:H681_05260 176 PLAKVAADDTQLKQ--VGEIqVGGAATAVYRLRYGAERSVLFASRGDQMLVLSNPKMLFSDAGDegl-------gePNVA 246 Pseudomonas s...
Q9HVT0         186 PLAHIAADDQQLRK--VGEL----AGTSVYRLRYGNDKAMLFLSKGDRLLLLSNPRMLFDDGGEsdd-------spLNAP 252 Pseudomonas a...
CAL92679       149 -MALPVLPDTQLES--AGTLrGGKARLLV--LQYGYGRQLLLAVEGDRVVALSDPGMLLVADDGdehageegaepvQDAR 223 Azoarcus sp. ...
Q13R71         149 GVGNVATSDAQLSQ--VAKL---SGDVPVYALKLAVGRTLLFASKDDRLVVLSAPGVLLDEKGG------------LLGE 211 Paraburkholde...
P17994         159 PLLFAATSDSQLSKteISSIkINSETVPVYQLRYNGNNALMFATYQDKMLVFSSTDMLFKDDQ-------------QDTE 225 Escherichia c...
AHG21338       167 PLAKVAAADTQLARmdFAPFkIGEETVSVYQLRYGNNKPLLFASHGDNLLLFSDIDMLYEQDA-------------PSQD 233 Chania multit...
jgi:Rpic_3312  214 QANALAALFSddagKRNVQATAYALPAQE------PTGHHVVVSANYLSFGYQQYFPGIEALRFDFGSGkdg----agnG 283 Ralstonia pic...
Q4K5A9         222 STTALEALLN----GDKLFPEAFGLEARKp-----EVQQRLAVNSSVLAMGYQRFIPNFAGLRFDMDDK----------G 282 Pseudomonas p...
PNU:H681_05260 247 VAKDLATLLE----GQQAFARQFGLEPSA------ELKQRITLGAGALAMGYQRFIPSFAGVRFEQGKD----------G 306 Pseudomonas s...
Q9HVT0         253 ASEDLEALLD----GDELFPERFGLPGRG------ELRQRITLNASVLAMGYQRFIPSFAGVRFEKGEQ----------G 312 Pseudomonas a...
CAL92679       224 AAALVARLLEsdaeRDSPFDAHFALAPAGa-----DEGHQLVVSSAFYTFGYGAFAPGVEALSFAFDDKg---------G 289 Azoarcus sp. ...
Q13R71         212 RADVVSGMLSs---GRDDAARAYQLDAPGe----sPKGHRLVVSANYLSFGYQAFFSGIDALRFDFSSTgnpaggrgvaN 284 Paraburkholde...
P17994         226 ATAIAGDLLS----GKKRWQASFGLEERTae--ktPVRQRIVVSARWLGFGYQRLMPSFAGVRFEMGND----------G 289 Escherichia c...
AHG21338       234 SSQVTRALLS----GDAPWPESFGLKARNavagadKTAHRISVSANYLGFGYQRFILAFAGVRFEMQPQ----------G 299 Chania multit...
jgi:Rpic_3312  284 WQS-AALIDPARLSAk-WDNAALWRALPSDPAACATLPVDWKAAGTLLKSVAGDakeiSEAAAHVG----DAFAGPAAAC 357 Ralstonia pic...
Q4K5A9         283 WHSyLAMQEQDNQPA--FDFKPIWQAMPMGASACVALPLAAEQQKPLLVKLGAE----EAVATTLT----EHMAGTAGLC 352 Pseudomonas p...
PNU:H681_05260 307 WHSyLALNEVARQPE--LDFTPVWQAMPMGASACVALPVTPGLYDSLLVRLGAE----QKMATSFS----EHLSGAAGLC 376 Pseudomonas s...
Q9HVT0         313 WSSyLALNEVERQPP--LDFAPVWQAMPMGASACVALPVTPGLYGVMLERLGAE----QKMAQAFS----EHLSGAAGLC 382 Pseudomonas a...
CAL92679       290 WRT-AALIDGARLPAggLDGAGLWPALPHGPSLCALLPADWGALAPLAARIGAGag-gESARAGVGelarELFGGPAAVC 367 Azoarcus sp. ...
Q13R71         285 WQT-SALIVPDKLPQq-WNSADLWRALPANPAACTSLPADWKEASGLLGKVAGGg---ADNAAAIG----DQLTGPAAVC 355 Paraburkholde...
P17994         290 WHSfVALNDESASVDasFDFTPVWNSMPAGASFCVAVPYSHGIAEEMLSHISQEn---DKLNG--------ALDGAAGLC 358 Escherichia c...
AHG21338       300 WASyLALNDPSAAGNanFDFSAIWKTMPMGASFCVAVPVAQNVPEYLLQRIDAIs---DRAESNAS----LAMSGSSGLC 372 Chania multit...
jgi:Rpic_3312  358 WYGKSSLVAPLFVAKLSSASQAEa--VKPALGALFGQIVGSYEAKAqadd--ksgPYKRLPVTTKPGPAnATLWQRPVSA 433 Ralstonia pic...
Q4K5A9         353 WYADSRLYTPLLVASLKDKDNAK---LDADLGKLFGSMVGTRESKV---------AERIFPVVEQQNGD-VHQWQRQVSS 419 Pseudomonas p...
PNU:H681_05260 377 WYSESRLHSPLLVVKLDAPASPE---LDEELGKLFGSLVGSFEARV---------GEGAFPVDSRPEGD-GRLWQRQVSS 443 Pseudomonas s...
Q9HVT0         383 WYASSRLHSPLLVGQLSAPASAE---LDDELGKLFGRVIGAKEAKV---------EGGSFPVEDRVDGQ-TRRWTRQVSS 449 Pseudomonas a...
CAL92679       368 WYGESRHYTPLFATTLRRDVDEA---WAKELAALFDSAIGKGE------------PAQRAPVEAGQRGS-ARLWRRTVET 431 Azoarcus sp. ...
Q13R71         356 WYAKSTLVAPVFVARVKKQDAADiaaLKTALGKTFGDVIGAYEAKAakadgadsaGYRRLPVTTREQGAdVTVWQRPVSA 435 Paraburkholde...
P17994         359 WYEDSKLQTPLFVGQFDGTAEQA-----QLPGKLFTQNIGAHESKA---------PEGVLPVSQTQQGE-AQIWRREVSS 423 Escherichia c...
AHG21338       373 WYPDSHLYTPLVVSQLATAADEQ---SDKRLAALFDTVIGAREKQP-------------VPVVASTKNQ-AQVWQREVSS 435 Chania multit...
jgi:Rpic_3312  434 RYGTAQSAGAPFAAQLSADRYFPVTLAIAGDVVVFSPDARLVEDALAVLAKRFPAVADSLPKDKadRIVLTMTPASLAPL 513 Ralstonia pic...
Q4K5A9         420 NFGQYPAKEAKDPQTITGRAFMQVSLARHGSTLVFSLDDKLVNKALGTLDKRFPPLADVVPKDA--LMPVYLGPQSLAQL 497 Pseudomonas p...
PNU:H681_05260 444 RFGQYPASEAENPDQVSGNGFFRVSLLRDGNTLLFSIDDKLLDKARNTLAKRFPPLADVLPRDV--QVPAYLAPNTLSDL 521 Pseudomonas s...
Q9HVT0         450 NFGAYPASQADNPDSISGRAFFRIGMARHGQTLLFSLDDQLLGKALDTLDKRYPPLAEVLPKDA--LVPAYLAPQPLSEL 527 Pseudomonas a...
CAL92679       432 PYG---ARRGEDEPALAP------TLAVSGRTLVFSPDAALVDKALDVGAKLYPAVGDSLPDGA--RTLALLEPAALAKL 500 Azoarcus sp. ...
Q13R71         436 RSGTALTSKASFASQLSAERYFPVTLALAHGYLIFSPDGRLVDDTLAVLDKRYPALADTLAPQRlpRTILTLTPSSAAAL 515 Paraburkholde...
P17994         424 RYGQYPKAQAAQPDQLMSDYFFRVSLAMQNKTLLFSLDDTLVNNALQTLNKTRPAMVDVIPTDG--IVPLYINPQGIAKL 501 Escherichia c...
AHG21338       436 RYGQYPLNESNSPESLAGSQFFRVSLARSHQTLLFSLDDKLVNKALQTLDKHFPPLADVLPPQA--VVPVYMAPEALSGL 513 Chania multit...
jgi:Rpic_3312  514 VRREAGAALPADQEAVFLNAAQTHLFPKLKALSGYAPVSLALDGGVLSSRG--WVPVTW 570 Ralstonia pickettii 12J
Q4K5A9         498 IQQETFDSLPQDMEPVFNNAAQTYLVPKLRTLGGYGKYALTLPDGSEPDGHwqWLPLQW 556 Pseudomonas protegens Pf-5
PNU:H681_05260 522 LQRETMDSLPRDIEPVFRNAADTLLLPRLKILATQGAYALTLPSGSEPSGDwqWQPLQW 580 Pseudomonas sp. ATCC 13867
Q9HVT0         528 LQRETLDSLPQDMEPVFRNAADTYLMPRLKTLAGKGSYALGLPAGSQANAPwqWLPLEW 586 Pseudomonas aeruginosa
CAL92679       501 VRKEVFAALPRDEEAVLRNAADANLLPRLEALAKYPPLRLVRAEGALEGRG--WHALQW 557 Azoarcus sp. BH72
Q13R71         516 IEREAGAALPADQEAVFRNASRTHLVPKLHALAHYPPVSLTLPQNLPGSTG--WVPVEW 572 Paraburkholderia xenovorans LB400
P17994         502 LRNETLTSLPKNLEPVFYNAAQTLLMPKLDALSQQPRYVMKLAQ-MEPGAAwqWLPITW 559 Escherichia coli K-12
AHG21338       514 FKQEVFASLPKNLEPIFHNAAQTLLLPKLTALAGQQSYALVLPANTEVKESwqWLPLQW 572 Chania multitudinisentens RB-25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap