3KE2


Conserved Protein Domain Family
HTH_43

?
pfam09904: HTH_43 
Click on image for an interactive view with Cn3D
Winged helix-turn helix
This family, found in various hypothetical prokaryotic proteins, is a probable winged helix DNA-binding domain.
Statistics
?
PSSM-Id: 370745
View PSSM: pfam09904
Aligned: 21 rows
Threshold Bit Score: 138.206
Threshold Setting Gi: 503112086
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KE2_B                     14 KQHKAFLRKLYLAHLXDDARH-NLLSLGKLTGXPRRTLQDAIASFADIGIEVEFVQ-DGERHNAGYYRIRTWGPISSAWX 91  Sh...
Q1QXF4                      5 KTQSSFYRRLYVAHLIADGTA-SVPALIEATGMPRRTAQDTVNALVELDIHCEFEQqPGARHHIGRYVIRDWGPIDPAWV 83  Ch...
tigr:AHA_1468               6 KTRTSFYRRLYVAWLISQGTD-TVPAIMEATGMPRRTAQDTLSALAELDISCGFEQtEGARHLQGHYRISDWGPINPAWI 84  Ae...
Academia_Sinica:M5M_11855   5 KTRTSFYRRLYLAWLINRGIN-NVPAIQAATGMPRRTAQDTLNAIHELDIACVFEG----ANKNGGYEIADWGPINPAWL 79  Si...
WP_011768699                7 KTQTSFLRRLLVAYLIDNDFN-TVPKIIDATGMPRRTAQDTIKALHEIEVKIE-------QSARGEYRITDWGAVNKDWV 78  Ps...
tigr:CJA_1047              17 KTKTSFYRRIYVTWLITQGIN-TVPKIMAATGMPRRTAQDTLAAIHELAIQLE--------NHNGTHRLVDWGAVNPHWV 87  Ce...
WP_013346820                1 mlNPTFCRRVLLLLAIEELDRpSVPALIRHLGWPRRTIQDILKALPGLGVQVQFVE-DGIRHNDGYYAIQSWGGLNSEWA 79  Fe...
WP_012019523                5 KTRTSFYRRLYLAWLIDSGQAtSIPALMAATGMPRRTAQDTLAALEELDIDCRFEQgEGERNNAGHYLIHDWGPIDKRWI 84  Ps...
PNU:H681_19075              5 KTKSSFYRRLYVAWLIDSGTAtSVPALMEVTGMPRRTAQDTLAALADLDIDCAFEQhDGERNNAGHYRIRDWGAIDPRWI 84  Ps...
Q6LQJ2                      5 KTKSSYYRRLYVAHLIETGIA-SVPALIEYTGMPRRTAQDTIKSLAELDIECVFQQtKGERNHSGHYTITNWGAINKQWI 83  Ph...
3KE2_B                     92 DTHVDEVKSLL 102 Shewanella amazonensis SB2B
Q1QXF4                     84 AAHAERLREAL 94  Chromohalobacter salexigens DSM 3043
tigr:AHA_1468              85 EAQLPAIKETL 95  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Academia_Sinica:M5M_11855  80 EANAGRLAEVL 90  Simiduia agarivorans SA1 = DSM 21679
WP_011768699               79 KNNLRHVCEVL 89  Psychromonas ingrahamii
tigr:CJA_1047              88 EVNIAQLKAVL 98  Cellvibrio japonicus Ueda107
WP_013346820               80 HNHKAELRAAL 90  Ferrimonas balearica
WP_012019523               85 AAHLQQIKTTL 95  Pseudomonas mendocina
PNU:H681_19075             85 AQHLAQIKDVL 95  Pseudomonas sp. ATCC 13867
Q6LQJ2                     84 KENLTDIKSAL 94  Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap