Conserved Protein Domain Family
DUF2121

?
pfam09894: DUF2121 
Uncharacterized protein conserved in archaea (DUF2121)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 401752
View PSSM: pfam09894
Aligned: 13 rows
Threshold Bit Score: 229.915
Threshold Setting Gi: 502945819
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57968           1 MSLIICYYGKNGAVIGGDRRQIFFRGSEENRKILEEKLYSGEIKSEEELYKLAEKLNIK---IIIEDDREKVRKIsDSVV 77  Methanocaldoc...
O26846           1 MSLIITYISSKGCVIAGDKRRIAYFGDKSSREVLEEELYTGKIKSDEELQRRASELGVN---IKVTDDTCKVRSL-GDVV 76  Methanothermo...
WP_013413908     1 MSLILAYVGKKGCVIAGDKRKIAYFGDKSSRKILEEKLYTGKIKTLDELFEEAKKLGVS---INITDNAKKVREK-GHVA 76  Methanothermu...
agres:mru_1563   1 MSLIIAYVGKKGCVMAADKRRIAYFGLKEQREILEQEIYSGEIHNDEELYARAEELDVN---LKVTDNACKVKSI-ENVA 76  Methanobrevib...
CDG65302         8 MSLIITYVGSKGCVMAGDKRSIGFLGDKEQREVLEEEMYSGKIKTTEELLQRAEQLDIN---LKITDDVEKVRKI-GDVL 83  Methanobacter...
Q8TNH4           1 MTLVIAFIGKNGAVMAGDMREITFEGEKPDREKLEKELYNGAIVTDEELARKAEEAGVK---ITVTDCKNKVSER-NGIL 76  Methanosarcin...
A0B8J8           1 MSLVIAFSGRE-AVIAGDRRSIAFAGDCRL---LEEELYSGRIHDDVELLRRAGELSAT---IYISDGREKVWRD-GDVL 72  Methanothrix ...
WP_013718183     1 MSLVVALTKSKEAVIGGDRRSITFLGSWPE---LEEELYCGRISDDEALLAKAMEIGAI---LQVTDGRDKVWRR-GDLL 73  Methanothrix ...
WP_014586755     1 MSLVVGFAGKKRAIVAGDKRSIAFFGRAEE---LEEELYGGEIRSREDLQRRCEELGSK---VAIADGREKVWDR-GGVL 73  Methanosaeta ...
Q8TYL1           1 MTLVLAYAGTDGALVAGDRRTLVARMDEEKMRKVEEKLYSGEIRTEEELESFLKDLDVEdgyFEFHDDRKKVWKVnDEVV 80  Methanopyrus ...
Q6M196           1 MSVVIGYYGKNGAVIAGDKRNLLFNGIESNRAKLEEVLYSGEIKNDEELFKKASEFEVT---VHINDTREKVKSL-GNLL 76  Methanococcus...
WP_013180795     1 MSVIIGYYGNNGSAIAGDKRNILFRGSEANREKLESLLYNGKLKNDKELKEKAEEYDVK---VHITDSQDKIKKL-DGCL 76  Methanococcus...
WP_011973890     1 MSIIVGYYGANGAVVGGDKRNIIFRGNAEQREELEKLLYSGNIKTDEEFKKIADEYGIK---VYIEDKQLKVREV-NGVL 76  Methanococcus...
Q57968          78 CGEVRSLGI-DAKRRRVYATKGKCAIVDILNDTVTNQTIKEGFgIVVLGNRFLKKKAEEELKRTAKlfPMMPIQQIEDAI 156 Methanocaldoc...
O26846          77 VGEISQKTPfETRRRRIYATTGAYQIIELTGSRITSMEKGDTA-IIVFGNKIAKEITNRFLKKRWK--TKTSLKDVADLF 153 Methanothermo...
WP_013413908    77 IGEVGIKAThSAKRRRLYATTNCYEIIELEGSKIVKRKKGNSA-LIVFGNRITKKISNEILKKEFN--PKMSLQEIANLF 153 Methanothermu...
agres:mru_1563  77 IGEVSSRGTmETKRKRIYGTSNGFKIIELSGSHVLNSKRGVSS-IIVFGNKVTKSLANKMIQERWK--PSFSLKYMGEIF 153 Methanobrevib...
CDG65302        84 VGEVKLRTTtETKRKRIYGTSGGYHEVELSGSQIKNAKSGQSS-IVVFGNKFTKEIANKHLQKYWK--SQTSIKEIAKIF 160 Methanobacter...
Q8TNH4          77 VGEVSSVERgIVKKRRLYASAGSYAIAELRDSELTLTSQGKGSnFIAFGNEFTKQVANKCFKDNWT--KKSKLQDAVKVL 154 Methanosarcin...
A0B8J8          73 VGEVTEVSAsSSKRRRVYVTSGAYLIVDVVDGNARISGRGGAS-LIILGNRHTRDAAGKALQGLGK--------ISADAI 143 Methanothrix ...
WP_013718183    74 VGEVTEITPqLERRRRIYLAPGSQLQVDITGKEVRIRDRGAMG-CIIYGNRFTQQIAVSIV-------VQADGRVDEALI 145 Methanothrix ...
WP_014586755    74 AGEVTEISAeRERRRRIYLVPGGYLLVEVDGKRAEISKRGAST-LIILGNRFTRDFAFKRLGSGRP--------PDEASI 144 Methanosaeta ...
Q8TYL1          81 AGEVGVRSAkGVRRRRVYATPGAHAIVELEGEKVLSKNFGGPA-LIVEGPKVVKELVIEFVNSELG--GKPDLESLRNAL 157 Methanopyrus ...
Q6M196          77 SGEVVSIGK-DSKRRRMYLTKEKCAIIDIENDQITNKSVKTGSgIVVFGNRYVKHFVESEIKKHVQklLKMSAREIRDLF 155 Methanococcus...
WP_013180795    77 MGEVKTISN-QSKRKRMYLSKNNCALVEIIDDDMTKKEIKKGSgIIIFGNKHLKQLVQAELQKNVNivKSGDILKIEKLF 155 Methanococcus...
WP_011973890    77 VGEVKSIGT-DSQRRRMYLSTGNCAIIDILNDTITKKSSNVGHgLILFGNRYLKEIVHNELKKDAPnfKNMPIEKVKNII 155 Methanococcus...
Q57968         157 KEIFEKLK-WHPTVSKEYDIYSVNKYEK------NFEEVIKKDI 193 Methanocaldococcus jannaschii DSM 2661
O26846         154 RELMDHVSsQTPSVGSEYDLFIKSPSLDkksahrLLSDTIVRDV 197 Methanothermobacter thermautotrophicus str. Delta H
WP_013413908   154 KKIIKKASeLTPTINKSCDIVIKNPILNkemaekILEMSISEDI 197 Methanothermus fervidus
agres:mru_1563 154 GEILKDIAeITPSVGKDYDVIIEKNNLAksqvqdyidevaerdv 197 Methanobrevibacter ruminantium M1
CDG65302       161 QRIMEDVAqSTPSVSPQFDIYTVHPQLNhkqameILRTTIVKDV 204 Methanobacterium sp. MB1
Q8TNH4         155 MLCMETAAkKTASVSKQFVIVQTSSNVD-------VLKLVEKDg 191 Methanosarcina acetivorans
A0B8J8         144 ARVMDEVSaGTATMSREHTLLKITAHHKdp--asILMQTFSRDC 185 Methanothrix thermoacetophila PT
WP_013718183   146 RKIFQEAAeRTASVSQEHVILKSERMLSnp--qkALEKALeedc 187 Methanothrix soehngenii
WP_014586755   145 RALFEEAGrATASVSPDYTVLTSSSIHRdp--eaALLRALREDC 186 Methanosaeta harundinacea
Q8TYL1         158 DDLFEYVSsGTILVSSEYDAYEVKGKADpla-raRLQKAIDEDI 200 Methanopyrus kandleri
Q6M196         156 EKILKNIE--NATLSDTFEYYVVEAGEP------EFEKAVNKDL 191 Methanococcus maripaludis
WP_013180795   156 KDILSNID--TPSSSNDVDSYSNFKYEN-------LEKVISQel 190 Methanococcus voltae
WP_011973890   156 ENAIKRCD--GPTVSEEIILLHTKDKHN------NFKELIKKDI 191 Methanococcus aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap