Conserved Protein Domain Family
DUF2105

?
pfam09878: DUF2105 
Predicted membrane protein (DUF2105)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 401737
View PSSM: pfam09878
Aligned: 12 rows
Threshold Bit Score: 211.78
Threshold Setting Gi: 124362932
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011973082     3 ITLLYNSTVFTGFIVGILSLFAISSsgknNNSDLDMVIYTNIVECAMVVIIAAVGTDLAEALILPGLVIGMAELLAVSEV 82  Methanococcus...
Q8TY35          11 TVKMYHVAVAAGIAVGLIAAVDIAA----DRNPLNRLTMTDALEVGSLTLLASVGTDLAECLILPGLVVGLAELIATAEV 86  Methanopyrus ...
ABN06740         8 MDLIYKIGLAVAFIAIIVAFSAVVR----ERDEISLLIIIDLIEITGLVVIALLATDLAEALILPGLVVGVAEIMAVSEL 83  Methanocorpus...
Q2FMA3           1 MMDFYQIGLLCTLICVTISFIALFR----ERDDIHKILVVDLIETTGLVLICLVATDLAEALILPGLVVGISELLMLTEL 76  Methanospiril...
EHQ34514         1 MDQTYFLGITVIFAASAIVFMALFK----EKNDLHRLILTDLAEIAALALIAMVATDLAEALILPGLVVGISELLAISEI 76  Methanoplanus...
Q57943           8 IYSIYHPTILVGFAIGILSLLAIGF----QKNDLHALILTDVVECAMLIIIAGVGTDLAEALILPGLVVSLAELLAVSEV 83  Methanocaldoc...
jgi:Mvol_1593    6 VSMFYSNSIIVGIIVGVISLYAISR----EKWDVNMIILSDVVELAMLIIVASVGSDLAEALILPGLVVGMAELLAVSEI 81  Methanococcus...
Q6LX98           4 VSLLFSKTVAVGFIVGIISLYSISR----QKSDLNMILLTDLIEYGMLVIIAAIGSDLAEALILPGLVVGMAELLAVAEI 79  Methanococcus...
WP_023992251    15 VVSLYLPAIVTGLLVGIIGLLAISY----QKNDLSALILTDIVGIGMLIMVAAVGTDLAEALVLPGLVVDLAEILAISEI 90  Methanobacter...
agres:mru_1406  14 YSSMYTTALYGGLIVAFIGLIGVAM----EKRDIQILILTDIVGLAMLIVVAAVGTDLSEALILPGLVVELAEIMAISEI 89  Methanobrevib...
WP_016358538    11 YANMYLPAFYTAIIVGFFTCIAIAM----QKRDIHVLILTDLIGFAMIIVVAGVGTDLAESFILPGLVVELAEIMAISEI 86  Methanobrevib...
O26490          28 TLSLFQPAIYTGLIAGFIALLGISF----QKNDLSALIITDIVGIAMLVIVAAVGTDLAEALILPGLVVELAEIMAISEI 103 Methanothermo...
WP_011973082    83 LVNRNEHRQKdkeiieinqrynlINKNNIkqhklleeflakdeahakisiNKMEVLYTAPKFMAIVLVVYGAILTGFTGG 162 Methanococcus...
Q8TY35          87 LVARYTDGDS-------------LPEFEP---------------------LDMEVLRTAPTAIMIGLVVYGVLLTGFTGG 132 Methanopyrus ...
ABN06740        84 WLVKEGLQNV-------------RPVRR----------------------LDIEVLHTAPPIIGALLTAYGIFLTGFTGG 128 Methanocorpus...
Q2FMA3          77 YIRKEKLP---------------LPAYKP---------------------IRIEVMRTAPPIITFALVVYGIILSGFSGG 120 Methanospiril...
EHQ34514        77 YLVREGLT---------------KPVRRK---------------------FRLEIMDSAPAIMALVLVAYGIVLSGFSGG 120 Methanoplanus...
Q57943          84 LITRKYLKSK---------------RPKPksyklfeefklplytgelkydIHMEILKTSPKFLAIILIVYGAILSGFTGG 148 Methanocaldoc...
jgi:Mvol_1593   82 YISRKNIADEk-----------iTCKSKSrksklleeftikgspnlnvefTKMQILKTSPKFIAVVLIIYGAILSGFTGG 150 Methanococcus...
Q6LX98          80 FVSRNDLRKE----------------GKPkksklleefmiketpkmdinfSKMEVLYTTPKFLAVILVIYGAILSGFTGG 143 Methanococcus...
WP_023992251    91 LMNREIRKKGkdv--------dlIPLPLK---------------------MDMEILTTAPTFLAIILVAYGAFLSGFTGG 141 Methanobacter...
agres:mru_1406  90 LISREMRKADkdt--------sfSPMPLD---------------------IDMEIMTTAPNFIALLLIGYGIFLSGFTGG 140 Methanobrevib...
WP_016358538    87 LISREMRKISsnqp-----nvsfAPMPMD---------------------YNMEILTTAPNFLSLILLAYGVFLTGFTGG 140 Methanobrevib...
O26490         104 LISREMRILGe------------VPVVEHr-------------------pMELEVFRTAPNFLALILIAYGVFLTGFTGG 152 Methanothermo...
WP_011973082   163 AVIACGLLFYLLSQRVLEKEVpfpklkvYWEGISGFSGIMWAIWIFGFIGLYLFPQHYIYFLLIAGC-ALALKVGSKLGL 241 Methanococcus...
Q8TY35         133 AVAGSGAAFYLFSRANRPHYE-------EWRGMESISGIGWAFWVAGFSTFFLHPKAWLLALILAGTgGILVKVGPKLTL 205 Methanopyrus ...
ABN06740       129 LIAGLGLALFFLGKATTE----------NFLSSENASGYAWVLWVLAFLIFILFPSQWFLALMAAAV-GIMIKVMAKIAL 197 Methanocorpus...
Q2FMA3         121 AVAGIGLVFYFLCKGYEE----------RFALLETISGYAWALWIVAFFIFMILPQAWLIAVMLSGG-AILVKVTTKMAL 189 Methanospiril...
EHQ34514       121 AVAATGAVFFFMCRGSVE----------RFEILEIVSGYAWAFWIAAFFIFMVLPQYWFFAVMLAGG-AILVKVMAKMSL 189 Methanoplanus...
Q57943         149 AVIATGLLFYALSQRVIGVEIsee-lktMWEGISGLSGIAWALWIFGFIGFFVFPDKWLLCLLMAGL-GLVIKVGSKLGL 226 Methanocaldoc...
jgi:Mvol_1593  151 AVMASGLIYYLLSKRVIGEKIskadflnIWDGFISFSGIAWALWVLGFLGFFIMPSKWSVFLLIAAL-GLVLKVGSKLGL 229 Methanococcus...
Q6LX98         144 AVMASGLLFYVLSKRVLGKKIlpeelkvSWEGISAFSGIAWAIWILGFIGFFLFPSKWPYFLIIAGF-GLAIKVGSKLGL 222 Methanococcus...
WP_023992251   142 AVAGGGILMYVLSKRMRGVPSd------TWEGVAGVSGIAWCLWLVGFVIFFAFPQFWLLALFLAAF-GVFIKVTFKMGL 214 Methanobacter...
agres:mru_1406 141 AVAGGGIVIYVLSRKVRGLPIf------VLDGVGAISGISWCLWIIGFIFFFILPQYWLLSLFLAAL-GLLLKVASKIGL 213 Methanobrevib...
WP_016358538   141 AVAGGGILLYILSRKARGLPVl------ELNGISGISGLGWCMWIISFWLFFTMPQYWLLCLFLAAC-GLLLKVATKMGL 213 Methanobrevib...
O26490         153 AVAGAGILFYVATRRARGLPTv------EWDGIAGISGVTWCLWLAGFLIFFTAPQLWLPALFMSGC-GILIKVASKMGL 225 Methanothermo...
WP_011973082   242 MGDLL 246 Methanococcus aeolicus
Q8TY35         206 LGYAM 210 Methanopyrus kandleri
ABN06740       198 VGTMR 202 Methanocorpusculum labreanum Z
Q2FMA3         190 IGTMQ 194 Methanospirillum hungatei JF-1
EHQ34514       190 IGTMg 194 Methanoplanus limicola DSM 2279
Q57943         227 IGYIG 231 Methanocaldococcus jannaschii DSM 2661
jgi:Mvol_1593  230 IGQVw 234 Methanococcus voltae A3
Q6LX98         223 IGELF 227 Methanococcus maripaludis
WP_023992251   215 IGVMG 219 Methanobacterium sp. MB1
agres:mru_1406 214 IGILM 218 Methanobrevibacter ruminantium M1
WP_016358538   214 IGVLM 218 Methanobrevibacter
O26490         226 IGVLA 230 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap