Conserved Protein Domain Family
DUF2103

?
pfam09876: DUF2103 
Predicted metal-binding protein (DUF2103)
This domain, found in various putative metal binding prokaryotic proteins, has no known function.
Statistics
?
PSSM-Id: 401735
View PSSM: pfam09876
Aligned: 23 rows
Threshold Bit Score: 101.598
Threshold Setting Gi: 74505219
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013194065      16 PYDKLGGSHSTIIGGRQGRRIIHIIGSHPEVKKIIPAVI-QVKAkkGVPGGAFSAKALRCDKRGNLRLVVSQGTSTQELR 94  Methanohalo...
WP_013320372       5 SNGRLVWNHSTHIRDL--IPVLEKLITQTGITTVTPGVIsRARA--HSPDLKLRVSVP---IRGGYKLIARQGKTVQEVF 77  Gloeothece ...
jgi:GEI7407_1767   5 PGGRLVWNHSTHLPGV--IPLLERLTLAPGIQTITPGVLgKARS--HVPKMKLRVSVP---IRGGFKVIARQGKTFQEVF 77  Geitlerinem...
jgi:Osc7112_2002   5 PKGRLVWNHSTHLPGL--IPILERLTLKMGIQTVTPGVInKVKG--HIPRMTLRVSVP---IRGGFKIIARQGKTVQEVF 77  Oscillatori...
Q8TYE7           139 PERKLGGSHSTIIGGRRGRELVLKVASVPYVKRVIPGRI-GAKG--SRGGGGVRLKVSRVDDSGNVKLLLSEGAATQEIF 215 Methanopyru...
WP_012941009     136 PEEKIQGSHTTIIGGRLGKEFLYKVALCEYVKKIVPGVI-TGGA--CSLGGGVRFKVTRCDEKGNIRALLIDGSSVQEIY 212 Archaeoglob...
jgi:Arcve_0220   142 PEDKIGGAHSTIIGGREGAKLLHRIATCEYVKKIVPGVI-EAKG--TAAGGGVRLKLNRSDERGNIRAILIDGASVQKVL 218 Archaeoglob...
O29765           142 PEEKIHGSHSTIIGGREGYKLILSLAKSPYVKKVVPGVI-EGNA--TSIGGGVKLKLTRSDEKGNVRALLIDGSSVQQVY 218 Archaeoglob...
jgi:Ferp_2283    135 PEEKISGAHSTIIGGREGFNLIMKLARSPYVKKVVPGVI-ENKG---TSQGGVRIKLTRSDDRGNIRALLIHGAAVQQIY 210 Ferroglobus...
CGB:Asulf_02012    2 gsSKLGGDHTTIIGGRRGRKIVAKISTSEKVKRIVPGII-KV-G--MSSGGGFRAKFLRPDERGNLRLLLREGSTVQEIF 77  Archaeoglob...
WP_013194065      95 IITTVGDTVEGKRVMDELNE 114 Methanohalobium evestigatum
WP_013320372      78 IVTDLNQAELENLIIQALk- 96  Gloeothece verrucosa
jgi:GEI7407_1767  78 IVTSLDQAQLEAAIAQVLEr 97  Geitlerinema sp. PCC 7407
jgi:Osc7112_2002  78 ILTTLSQGDLEETIAQTLAk 97  Oscillatoria nigro-viridis PCC 7112
Q8TYE7           216 VVTTARDEREGKLVAELLER 235 Methanopyrus kandleri
WP_012941009     213 IVTTAKNKEQGEVILRMLKS 232 Archaeoglobus profundus
jgi:Arcve_0220   219 VITTASNAEEGEEVRKILEG 238 Archaeoglobus veneficus SNP6
O29765           219 VITTASSREEGEEVLKLLSG 238 Archaeoglobus fulgidus
jgi:Ferp_2283    211 VITTASNKEEGEVVLKELis 230 Ferroglobus placidus DSM 10642
CGB:Asulf_02012   78 IVTTAKNFKEGSDIIKELER 97  Archaeoglobus sulfaticallidus PM70-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap