Conserved Protein Domain Family
DUF2095

?
pfam09868: DUF2095 
Uncharacterized protein conserved in archaea (DUF2095)
This domain, found in various hypothetical prokaryotic proteins, has no known function.
Statistics
?
PSSM-Id: 370731
View PSSM: pfam09868
Aligned: 2 rows
Threshold Bit Score: 220.687
Threshold Setting Gi: 74502751
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8U0I1   6 EKKKKPIDQLPWQEYDIEEFRQRFPALARELEEDRGIEISGIRLDEYQVLEEEEEEgKIDFSGYNPTIIDFLRRCDTDEQ 85  Pyrococcus furiosus
Q5JDX7   8 EVKKRPVDEFAWQEYDLEEFKRTFPALARELEEEPGLSIDAYRTSEEEALEEEELE-LQDFSGYNPTIIDFLRRCETDDE 86  Thermococcus kodakare...
Q8U0I1  86 ALEIINWMEEHGEITPEMAKELRVTLVHKGVRAFGPKKEWGWYERHGKH 134 Pyrococcus furiosus
Q5JDX7  87 ALEIINWMEERGEITHEMAKELRIVLAKKGVRAFGPKKEWGWYERHGRH 135 Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap