4YNS


Conserved Protein Domain Family
DUF2088

?
pfam09861: DUF2088 
Domain of unknown function (DUF2088)
This domain, found in various hypothetical prokaryotic proteins, has no known function.
Statistics
?
PSSM-Id: 401722
View PSSM: pfam09861
Aligned: 32 rows
Threshold Bit Score: 206.672
Threshold Setting Gi: 119536893
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4YNS_A             8 YDKR--TITAQIDDENYAGKLVSQAatYHNKLSEQETVEKSLDNPIGSDKLEELARGk--HNIVIISSDHTRPVPSHIIT 83 
Q2RH63            18 YGQG--YLVGELPEGIKVKEVVPSE--IAGVPDPSADVRRALEQPIGNHGVEELRGV---RQVVIVVSDLTRPVPNDVIL 90  Moorella th...
Q24SF3             8 YGHG--TQACLIPDDVDCVYGRLKS--VEPTAEAGEQISAALQNLIGNINFDKLRNa---KSVAIAVSDMTRPVPSRLIV 80  Desulfitoba...
Q5HRD7             9 YGKS--EIEINVPDDS--TIIEPQN--INAIQDYESAIKNVLRNPTNSKSLKEMVNSn--DIVSIVISDITRPTPNHILV 80  Staphylococ...
Q7MSU0             7 YGKEe-KIHLEIADSQLIGVYEPNS---VEKIDYAKAIDEALAKPLGKDSFDHFINTs--ERIVFIVNDGTRPTPTRKVL 80  Wolinella s...
Q12XD0             7 YGNDfvDIDVTIPHE----VLSPNE---PEVGDELSIILEALSNPVEKEPFVEFANNa--DKILVIVNDATRPTPTARVL 77  Methanococc...
jgi:Anae109_0509  33 LGYG--ARPLPLPDVPGARVLLPPV--APPVAELAAALDAALAHPVGARPLASVATAr--TRVVVIVSDSSRDEPRSELF 106 Anaeromyxob...
Q67NT5             7 IGQS--EMLLELPDENLKGILLPNE--VAPLPNPLKTVEHVLKSPTGTPPLAELLRArrpERVVIIVNDITRPTPYDIML 82  Symbiobacte...
O30187            10 YGDK--PLLFEPPESWEVSVFRMAG--DSAREVEKEEIFRVLREPIGQKALSKLAEEr--GEAVVVFDDMTRPTKLKGIA 83  Archaeoglob...
Q2RKJ2             9 YGTH--KLTFHIPEEKIKAVLSPVA--MKEIPSTEVEIQRALENPIGCQSLGTMVSPt--SRVLLLCDDNTRPTPANIIV 82  Moorella th...
4YNS_A            84 PILLRRLRS-VAPDARIRILVATGFHRPSTHEELVNKYGEDIVNNE----EIVMHVSTDDSSMVKIGQLPSGGDCIINKV 158
Q2RH63            91 PVLLEKLNAiGIKDEQVTILVGTGLHRPAPPEEFPLIVGPEVAARV----KVISHDAYAPGILQQIGVSSRGTPIWINRH 166 Moorella th...
Q24SF3            81 EKLLPWLAEfGIHGDQITVLVGGGLHHPATQEEMNYILGEELPKKIk---QVLPHDADDRDCLNFLGTSPLGTPVYVNQH 157 Desulfitoba...
Q5HRD7            81 PLLIEELNH--VPRENFVIINGTGTHRDQTRDELIQMLGEDIVNSV----KIVHKHCSEKESLAKVGHSQYGCDVYLNKA 154 Staphylococ...
Q7MSU0            81 AQIYPKIK-----NRDIFFIIATGCHRAPTQEEYHFIFGKEIYEDLarqnRIWSHDS-RKDEMVYLGKSTNGTEMYLNKI 154 Wolinella s...
Q12XD0            78 EEVQDTLRS----HPDVKFIVATGAHRGPTEDEFRFIFG-NLYDEFk--dSIYVHDARKDEDMEYLGVSSNGTEIYLNKM 150 Methanococc...
jgi:Anae109_0509 107 SAVRRALAA--VPDDHLTVAVANGTHGPKPLERLG--LPEEVLRRH----RVVNHDARDDASMVEMGRTSRGTRIRVNRC 178 Anaeromyxob...
Q67NT5            83 PPLLRTLDEaGVRPEQVTFVVATGIHRPHTDEENRRIFGADVVNRY----RFVNHDC-VADDLVTVGRLSDGTDLTVNRH 157 Symbiobacte...
O30187            84 KAVIEELKRgGVSDENITFICANGAHGTYDRDDFAKKLGEEIVESY----PVFNHN--PLGNLDYLGETSAGTPVEINSE 157 Archaeoglob...
Q2RKJ2            83 PAILRELESgGVRKENIKILMALGTHRPMTLEELQQKLGAEVLAQV----EVINHDFRNPMALHDFGLTANGTPVKVNRV 158 Moorella th...
4YNS_A           159 AAEADLLISEGFIESHFFAGFSGGRKSVLPGIASYKTIMANHSGeFInSPKARTG 213
Q2RH63           167 YLEADGRILIGMIDPHQFVGYTAGSKSLVIGCGGEATIRANHAH-LV-EPEATLG 219 Moorella thermoacetica ATCC 39073
Q24SF3           158 FAQADFKIVTGMVDAHQFMGFTAGVKGAVIGLGGRETITGNHVR-LF-QPGAELg 210 Desulfitobacterium hafniense Y51
Q5HRD7           155 YVESDFKIVTGFIEPHFFAGFSGGPKGIMPGIAGLETIQTFHNAkMIgDSRSTWG 209 Staphylococcus epidermidis RP62A
Q7MSU0           155 VANAKKVCAIGSVEPHYFAGYTGGRKAFLPGVAAYETIQQNHLL-ALhENAQALS 208 Wolinella succinogenes
Q12XD0           151 VREAGNILVIGSVEPHYFAGYTGGRKAFLPGVAGFKTIEMNHKH-ALsNKAQSLA 204 Methanococcoides burtonii DSM 6242
jgi:Anae109_0509 179 VAEADLVVSTGKVKPHYFAGWGGGAKGIFPGLGHDVDIRQNHKL--KaDPASALG 231 Anaeromyxobacter sp. Fw109-5
Q67NT5           158 VAEADFLITTGLIGLHYFAGYSGGRKSVLPGVAGKSLITHNHRK-MT-DPRAATA 210 Symbiobacterium thermophilum
O30187           158 VMSYSLKIGLGCILPHPQFGYSGGAKIVLPGIAGMRSIAYNHGV--IgGWSAAMA 210 Archaeoglobus fulgidus
Q2RKJ2           159 VLEADVVIGIGSIVPHHIPGYSGGAKIVQPGICGEDTTAATHLL-SVrTRRNMLG 212 Moorella thermoacetica ATCC 39073
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap