Conserved Protein Domain Family
YjhX_toxin

?
pfam09857: YjhX_toxin 
Putative toxin of bacterial toxin-antitoxin pair
YjhX_toxin is a putative toxin of a bacterial toxin-antitoxin pair, which is neutralized by the proteins YjhQ in family pfam00583.
Statistics
?
PSSM-Id: 401718
View PSSM: pfam09857
Aligned: 24 rows
Threshold Bit Score: 113.919
Threshold Setting Gi: 529583688
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
C1D6C9                         1 MNISRPEQRTLHVLAKGGYIVRIRDDAGRITTVECHTREGHILSDCTLAVFQKLKAKRLVSSKNSQPYRINRNGLLAVRA 80  Laribacter hongkongensis HLHK9...
WP_014130760                   1 MDISRDEQRVLHALAQGGYIQPLKDARGKIADIECYNRDGWLLTQCDMTLFKKLRRRKTIASQDGGPYRITRRGVMLVRS 80  Pelagibacterium...
Q11HK9                         1 MDISRAEQRILHILAQGGCIQVEKDEDGRIAEISCVTRDGWHLPGLDLALFRKVKRKGAIASTNGGPYRITRRGLQLVRS 80  Chelativorans sp. BNC1...
Q0BWN3                         1 MDISRAEQRILHLLAQGGRIDLVRDEAGKLTDAHCYSRDGWRYTGLDMALFRKLKRRRTIASERGQPYRITRRGLQLVRS 80  Hyphomonas neptunium ATCC 15444...
Q8UFS6                         1 MDISRAEQRILHLLAQGGRIELVRDDTRKIEKITLYTRDGWIFGGLDLLTFRKLKQKRAIASSGGKPYRITTRGLELVRG 80  Agrobacterium fabrum str. C58...
Q2K936                         1 MDISRTEQRILHLMAQGGRIEIIRDDNRKIENVSCFTRDGWLYPGVDLDLFRRLKRLKAIKSSGGQPYRITERGLRLVRS 80  Rhizobium etli CFN 42...
Q92QK6                         1 MDISRAEQRILHHLAQGGRIEITREGKA-IAEIRCFTRDGWVYPGVDLELFRKLKRKRAIKSSAGKPYRITERGLHLVRS 79  Sinorhizobium meliloti 1021...
PRJNA212980:JCM7686_pAMI4p240  1 MNISKIERRALEMLSFGGRIIVEKAGRTTLVEVSFVSREGWFLDGIGEKEFRALRSKKLILSRNGGDYRITRKGIEAL-- 78  Paracoccus aminophilus JCM 7686...
Q5E6I2                         1 MNISKQEQRVLHTLAMGGEIRRYLNEDGKLTEITCFTREGYGLSNCTMDTFKKLKNKKLISSKGGRPYRITPLGATSAQA 80  Aliivibrio fischeri ES114...
B2IC04                         1 MNISRSEQRVLHVLAQGGYVRHQRADNGRILDVLCFTRDGHVLADCTLEVFVKLRRKRLIESKASSPYRISDKGRRSVRA 80  Beijerinckia indica subsp. indica ATCC 9039...
C1D6C9                        81 QLDNQ 85  Laribacter hongkongensis HLHK9
WP_014130760                  81 QTDNR 85  Pelagibacterium
Q11HK9                        81 QTDNR 85  Chelativorans sp. BNC1
Q0BWN3                        81 QPDNc 85  Hyphomonas neptunium ATCC 15444
Q8UFS6                        81 ELDNR 85  Agrobacterium fabrum str. C58
Q2K936                        81 QLDNR 85  Rhizobium etli CFN 42
Q92QK6                        80 ELNNR 84  Sinorhizobium meliloti 1021
PRJNA212980:JCM7686_pAMI4p240 79 ----Q 79  Paracoccus aminophilus JCM 7686
Q5E6I2                        81 QMNQR 85  Aliivibrio fischeri ES114
B2IC04                        81 QLDNR 85  Beijerinckia indica subsp. indica ATCC 9039
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap