4YIY


Conserved Protein Domain Family
ABC_ATPase

?
pfam09818: ABC_ATPase 
Click on image for an interactive view with Cn3D
Predicted ATPase of the ABC class
Members of this family include various bacterial predicted ABC class ATPases.
Statistics
?
PSSM-Id: 401685
View PSSM: pfam09818
Aligned: 31 rows
Threshold Bit Score: 417.396
Threshold Setting Gi: 121697587
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4YIY_B          63 FSPLMDFFHSVEGRNYGELRSLTNEtYQIS-----En--VRCTFLSIQSDPFAPGSQVRLVCPCTFSle----------- 124 Trypanosoma b...
Q5SKP6           3 LEDLLDRLEALEGKPYPFYKDLKGVwRGKG---------FALRFVYVQGDPFATPSVLEAIYPGEAL------------- 60  Thermus therm...
imbp:Hbut_1028   5 QCGLERLLRRLDGRGYRAYRELKGCiTRVD-----G---FEIRVVRVQPDPYAPPSVVHVMGRLEAPd------------ 64  Hyperthermus ...
jgi:Igni_0492    8 AVDVEKILAKIDGRGYKAYKELKGVrFSVG-----R---LAFEVARVQGDPFAPPSVVRAEAPA---------------- 63  Ignicoccus ho...
Q9YAY5           4 RISIESVLRRIDGRGYKAYKDLTGAsEDLG-----R---LEIRVTRVQGDPFAPPSVVEVYVRGVSP------------- 62  Aeropyrum pernix
jgi:Smar_0596    6 VDELSTFLKMFSNKRYGYYKTLKSIvINYD-----N---VRASFTRIQSDPYAPPSILEFIVPRNIH------------- 64  Staphylotherm...
Q59022          13 NEFLNTTLLTKSNKNKLYYAVKQP-----------DgniKVVLPFVFENKNFLKLSEYKDGIEGATQ------------- 68  Methanocaldoc...
XP_001466191    83 LVALESFLRDVDGSNYSQLKQLTGRtYSLTrqmrpDpasVSIRFVRIQPDPFAPGSQVCVSVPAPFAthtllhsahstpp 162 Leishmania in...
Q4N1S1         157 TGKLYWNLREKQGDPYSSYKRLLGE-WTLD-----Eg-dITVIFDRIQSDPFAPPSNVRVRIPQDTA------------- 216 Theileria parva
XP_001611876    67 TGSLIIHLKNKNGGPYGSYKSLQGE-WRLV-----Ns-pISLIFDRFPDDVI---------------------------- 111 Babesia bovis...
4YIY_B         125 ----kVLQTTDLaaANPCRRVAAEDFIL-RSFHAGYr-----nGIPRRTSGAVQVLRPSQHVLERSTVGLvkahq---qk 191 Trypanosoma b...
Q5SKP6          61 --------EALRvyTREEGRVAVEDFLL-RALKARLrdl--prLAGSGHSGAVRVEVESPKVLRRAGAHL---------- 119 Thermus therm...
imbp:Hbut_1028  65 --------------WALEHPVALADYLY-RRLYRALrsa--aeRMGEGRSGFLSVPRPSPVMLRRSGLEVs--------- 118 Hyperthermus ...
jgi:Igni_0492   64 ---------------RCDLPLPAEDYFL-RKLYASLray--ssKMGEGKSGLLAVPKPSNAILRRSSVKC---------- 115 Ignicoccus ho...
Q9YAY5          63 --------------PAGAHPVPYADYVH-RLLSRVLpry-smrGVGEGGSGKLSVPTPSPIIIPRSAVEAq--------- 117 Aeropyrum pernix
jgi:Smar_0596   65 -----GLKLKRF--RVRDYQV-LSDYLY-RRLYSESiry--rwKCGSGYSCFLGVPKPSPIMIYRSGAEI---------- 123 Staphylotherm...
Q59022          69 -----RVIEEIKqeIIKKKRFLPLAGYFgRIYKALYepl-tvvNCNLNLGYDLWKVDKYNYIE----------------- 125 Methanocaldoc...
XP_001466191   163 gvtaaALGNPLPpeDVACRRVAAEDFIL-RCVKGGF-------SAGPNTSGAVQIIHQSQHVIARSAVQLlgaseandsd 234 Leishmania in...
Q4N1S1         217 -----RFPYDLM--IPKIRNIASCDYIA-RSISEELtamsrewESRSLKKRGFHISKPTQYVLERKSVIL---------- 278 Theileria parva
XP_001611876   112 --------------TDKLRNVAACDAIT-RKICDELkvl-sskAKYGSDRKHFQMMNPSQYVLPRKTVVL---------- 165 Babesia bovis...
4YIY_B         192 sgMQAEI---EIFARVKLPGHGRRIDGHGAIDIFYNELVPLLEQCVVGL--NEEDLHQHVICVHDQEELRSNLLGAGYVA 266 Trypanosoma b...
Q5SKP6         120 --GKKAL---SLRFRVGLPAQGRRILGREARRLF-QALSRHLEAFLQEL--DREALLRHVRQAEDFAFIQERLAERGLVA 191 Thermus therm...
imbp:Hbut_1028 119 --SDGRF---IARIWVGLPSRRRRVLGNAAMELLLEKIPRAIRRVVEGL--GGRDLEEHIRVWRLQEELRSSLPRYRLVA 191 Hyperthermus ...
jgi:Igni_0492  116 --FGNKI---AFRIWVGLPSRGRRVLADRASELLLRKLPKAVEEALS----RDEDLERWNKVWKVQQEIRKKMAEKGLIA 186 Ignicoccus ho...
Q9YAY5         118 -pRGDGVwslLLRVWVGLPSRGRRVLGRAARELLLERLPKAVLTVLEGL--KGGGVEQHITVWKDQEHIRSRLEDMGLYA 194 Aeropyrum pernix
jgi:Smar_0596  124 --VGGDI---VLRIFIGLPASGRRILVKPLIHILSIIIPRIIDKFRNLYk-CEKEIWERVLYFRDYLYIQELLADENAVA 197 Staphylotherm...
Q59022         126 ---GDKI---YLMLRMIF-KEKDSKEIVKQINELCNDLDKFIKKI------PIDLLIDEAKNIINQKYLRDKLDELGLVC 192 Methanocaldoc...
XP_001466191   235 gaSDGWI---HVYFRVKLPGHGRRIDSQRIRQILFSEVLPVFQENVLRC--DHRALWAHVTCVHDQEWLRAQLREWGFAA 309 Leishmania in...
Q4N1S1         279 --NKEFV---ELRLYAHMPSNGRRIDGKYAAKLFTDILPKICKAYLNFEsyDKEQFYKHVKCVEDQQHLRNSLEDLGLVA 353 Theileria parva
XP_001611876   166 --TDRYL---EARMFAHMPANGRRINGTLAVYMFNEILPALVRNAMNYSayDSKQFYEHIYSVEDQEALRAQLDALGLVA 240 Babesia bovis...
4YIY_B         267 FVANGAILPRDAGNSDK------PLRd-NAVPFQSPKSLE-CSFTLPHsGKTITGMGLPPG-LTLIAGGGFHGKSTLLRA 337 Trypanosoma b...
Q5SKP6         192 FVGEGSLLPRESGVSQR------PLK--GAVPFQSPPSLK-VAFRTPH-AGEVWGMGLPQG-LTLITGGGFHGKTTLLEA 260 Thermus therm...
imbp:Hbut_1028 192 FVGDGSILPRRCGTCED------PLP--GAVPFESPPSLR-VEIETSV--GAVTGMGVPRG-VTVIAGTAFHGKTTLLEA 259 Hyperthermus ...
jgi:Igni_0492  187 FVADGSVLPRRCGDCEE------PLE--GAVPFESPPSLR-VEIETNE--GPISGMGVRKG-ITSVTGPAFHGKTTLIEA 254 Ignicoccus ho...
Q9YAY5         195 FVGDGSILPRKCGGCWE------PLE--DAVPFESPPSMR-VEIELPS-GKVVSGMGLPRG-VTTITGPAFHGKTTLAEA 263 Aeropyrum pernix
jgi:Smar_0596  198 FIANNSILPRESSISQK------PLS--NAVPFSIEDKYS-REIRLPS-GKTIYGLIIPQG-LTVITGGGYHGKTTLLEA 266 Staphylotherm...
Q59022         193 FIANNSKPARKYTEVRRhyriagPKD--VNIPFECPEELEpIEIELKY-GKKVKGLGIKKKeIFIITGRNAQGKTTLLQA 269 Methanocaldoc...
XP_001466191   310 FIADGAILPRAAGNSDK------PLSgpSVVAFSSPATLQ-HTFQLPYsGRAISGAGLPHG-LTLIAGGGFHGKSTLLRA 381 Leishmania in...
Q4N1S1         354 FVANGAMLPRESGTSDK------PLK---SPLFKSPANLE-VTIKTPN-KGDVTGMGIKAG-VTVIVGGGYHGKTTLLES 421 Theileria parva
XP_001611876   241 FVGNGSILPRASGVSEM------PLKgpGVQPFESPASLQ-ISVTLPN-KGTITGLGLKRG-VNLIVGGGYHGKTTLLEA 311 Babesia bovis...
4YIY_B         338 LEVGIYNHVPDDGRTYVVVDPTAVKIRAEDRRSVHGVDISPFINNLPFGKTTN-FFVTADASGSTSQAANIMEALELGSQ 416 Trypanosoma b...
Q5SKP6         261 LVHGVFPHVPGDGREWVVTDPLAQRVQSEDGRSMKGVDLRPFVHDLPLGQDTA-FFSTEDASGSTSLAAAILEALEMGAR 339 Thermus therm...
imbp:Hbut_1028 260 IQYGIYNHVPGDGRERVVSLRSTVKVRAEDGRYVSCVDISTFIHSLPARIDTS-CFTTWDASGATSMAAAVQEAVEAGAE 338 Hyperthermus ...
jgi:Igni_0492  255 LAKGVWDHIPGDGREFVLSDKNMFYVRSEDGRRVAGVDVSTFIKL--EGSE---RFSTDDASGATSAAASFQEAVEAGSR 329 Ignicoccus ho...
Q9YAY5         264 IAQGVWNHIPGDGRELVVSDHMLAYVESENGRWVSCVDASPFIEALPGGADTR-CFTTPDASGATSIAASIQEYVEAGAS 342 Aeropyrum pernix
jgi:Smar_0596  267 LQEGVYPHIPGDGREYVVSRPRTVLVKAEDGRFIHRVDISSFIKKTPVIGDTK-DFISRDASGSTSMAASINELVEAGVD 345 Staphylotherm...
Q59022         270 IDSGRDDHLIGDGREFIITTKSLSKAST-GSMEMSGQDISLFFQKLPPGIKGSpKAVYGTASGSMYMAYQIQRAIKNKTK 348 Methanocaldoc...
XP_001466191   382 LELGVYNHVPDDGRTFVVVDPTAVKIRAEDRRAVHGTDISPFITNLPYRDNTT-AFVTADASGSTSQAANIMEALELGST 460 Leishmania in...
Q4N1S1         422 LQLGIYNKVPGDGREFVVTSPNCVKIRAEDGRSVRKLDISTFIGNLPNGKSGT-EFTTDDASGSTSQAASIVESIEMGAD 500 Theileria parva
XP_001611876   312 LQVGCYNKVPGDGREFVVTSRNAVKVRAEDGRSVGSIDISTFIGTLPSGKDCS-CFSTTDASGSTSQAAVIMESIEMGAD 390 Babesia bovis...
4YIY_B         417 LLLLDEDTCATNLMYRDALMQMLVPRAQEPITPFVERVADLSQNHGVSSIMVI-GGSGQYFPQARVVLVMNAYQISDCTK 495 Trypanosoma b...
Q5SKP6         340 VLLLDEDTSATNLLVRDARMQALV--RRETLTPILDRVQDF-KALGVSLVLVV-GGVGDYLDLADTVVLMEAYRPQEVTA 415 Thermus therm...
imbp:Hbut_1028 339 AILIDEDTSATNLLFYDERSASLI--RRKTVTTIAEQAKSM-SEKGVSLVIVS-SGSAPLLAAADTVVVMEDYRPRDATR 414 Hyperthermus ...
jgi:Igni_0492  330 ALIIDEDYTATNFLHFDERLNEIY--DIKTVETLSEKLESL-KEFGLSLVLVS-GGSAPVVARSDTVIYMKNYKPHDVTE 405 Ignicoccus ho...
Q9YAY5         343 GVLFDEDQTATNIIHRDVWAEEIT--GKRTVNPLSDMAPSM-KKAGLSMIAVA-SGAMPLLESSDRIVVMDEFRARDATE 418 Aeropyrum pernix
jgi:Smar_0596  346 NILLDEDTSATNLLYKDEYMARLL--SDDPITTITQLARSFTRKTGINLVVVS-SASSILLSKADFIILMRNYKPSILSR 422 Staphylotherm...
Q59022         349 LILIDEDNSAVNLLV-----SGVLSKWFEGVKSLAEIIMEDREKLGDSSFIIVtSSLDLLTALGDRAIYLEDHKAKYLD- 422 Methanocaldoc...
XP_001466191   461 TLLLDEDTSAANFMYRDPLMEQLVPRTQEPITCFVHRARDLMYHHGVSVIMVV-GGSGQYFPMADVVLLLNAYKVTDATA 539 Leishmania in...
Q4N1S1         501 LLLIDEDISASNFMYRDKLMDLLVSKDKEPITPFLSLVRPFYDKMNVSTILVS-GSCGLFTTQADLVLQMDEYSCLDKTL 579 Theileria parva
XP_001611876   391 LLLIDEDISATNFMYRDHMMDSLVSSNCEPITTFLLLVQAFYQKLGVSTILVS-GACGLFMDQADTVIQMNQYKCLDKTE 469 Babesia bovis...
4YIY_B         496 E-------AKEIASN----SSLPal----------nPP 512 Trypanosoma brucei brucei TREU927
Q5SKP6         416 E-------ARAIARA----HPTGrafgepryplravPR 442 Thermus thermophilus HB8
imbp:Hbut_1028 415 E-------AKQLATQ----PGGAdyk-------ppsPR 434 Hyperthermus butylicus DSM 5456
jgi:Igni_0492  406 R-------AKRIEVR----APPSeys-------pprAR 425 Ignicoccus hospitalis KIN4/I
Q9YAY5         419 KrmeasrvLREMGYR----RAAKeyt-------rpsGR 445 Aeropyrum pernix
jgi:Smar_0596  423 E-------EIGLVEK----LPDKqyr-------pprER 442 Staphylothermus marinus F1
Q59022         423 --------LTYFREE----LGRYylelas-kfigvkIR 447 Methanocaldococcus jannaschii DSM 2661
XP_001466191   540 R-------AKAIAAQ----SVGGggvg------lveSA 560 Leishmania infantum JPCM5
Q4N1S1         580 E-------AKSLFEEavdtLPKVdltklklfsglinSR 610 Theileria parva
XP_001611876   470 E-------AKLVVSQ----HNVNlke--------aidK 488 Babesia bovis T2Bo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap