Conserved Protein Domain Family
XK-related

?
pfam09815: XK-related 
XK-related protein
Members of this family comprise various XK-related proteins, that are involved in sodium-dependent transport of neutral amino acids or oligopeptides. These proteins are responsible for the Kx blood group system - defects results in McLeod syndrome, an X-linked multi-system disorder characterized by late onset abnormalities in the neuromuscular and hematopoietic systems.
Statistics
?
PSSM-Id: 401682
View PSSM: pfam09815
Aligned: 130 rows
Threshold Bit Score: 141.594
Threshold Setting Gi: 215508972
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008980896 114 LWILAAVAVYFADVGTDVWLAVDYYLRGQRWWFGLTLFFVVLGSLSVQvFSFRWFVHDFSTEDsataaaasscpqpepnc 193 white-tufted-ea...
AAU94452      39 LSVVLATALYCAEFVSAAVLSGKYHSTKDDTWLGFTITFMLVPAVLIQ-LALTFIHRDAGRDR----------------- 100 spotted green p...
XP_005992052  35 FSILISTILFCGELIAAGVLCGCYNQSKDQVWLALTLTFMLVSSVLIQ-FALIFIHRDLTRDR----------------- 96  coelacanth
Q5GH21        31 FSIFTSTILFCAEIVAASVVAAGYSYSEDESWMSLTIVFMLVPSIMVQ-LTLTFIHRDLGRDR----------------- 92  tropical clawed...
XP_004940756  21 lgIVFSTALFCGESAAAAVLCFSYSHSDDRFWLALTIFFVLCPSVLVQ-LTLIFVHRDLSRDR----------------- 82  chicken
XP_002719876   5 aSVLASVFLFVAETTAALYLSSTYRSAGDRMWQALTLLFSLLPCALVQ-LTLLFVHRDLSRDR----------------- 66  rabbit
XP_001514150   5 wsVAASVCLLGAEAAGALGLSRAYWAAGDGAWHGLTLLFWLLPCALVQ-LTLLFVHRDLSKDR----------------- 66  platypus
XP_003218964   5 gSVLVSLFLFVAETACALYLSSTYCSAGDRIWQSLTLLFALLPCVLVQ-FSLVFVHRDLSRDR----------------- 66  green anole
NP_001027881   5 sSIFVSVSLFTAETTAALYLSSTYRSAGDQIWQALTLLFTLIPSVLVQ-LTLTFIHRDLSRDR----------------- 66  torafugu
XP_029702972  37 fsivlatvlycaefvsaamlsninrKTEDDIGTGFTITFMLVPAVLTQ-LALTFIHRDVGQDR----------------- 98  torafugu
XP_008980896 194 ktvagggsaagegearpstpqrqasnasksniaaansgnnssggtrasgnhrsascsfciwLLQSLIHILQLGQIWRYFH 273 white-tufted-ea...
AAU94452     101 -------------------------------------------------------------PLVLLLHLLLLGPVIRCFE 119 spotted green p...
XP_005992052  97 -------------------------------------------------------------PLVLFLHLLQLGPLVRCME 115 coelacanth
Q5GH21        93 -------------------------------------------------------------PLILLMHLLQLGPIIRCVE 111 tropical clawed...
XP_004940756  83 -------------------------------------------------------------PLVLLMHLLQLGPIIRCVE 101 chicken
XP_002719876  67 -------------------------------------------------------------PLVLLLHLLQLGPLFRCFE 85  rabbit
XP_001514150  67 -------------------------------------------------------------PLLLLLHLLQLGPCVRCVD 85  platypus
XP_003218964  67 -------------------------------------------------------------PLVLLLHILQLGPIVRCVE 85  green anole
NP_001027881  67 -------------------------------------------------------------PLVLLLHLLQLGPIVRCLE 85  torafugu
XP_029702972  99 -------------------------------------------------------------PLVLLLHLLLLGPVIRCFE 117 torafugu
XP_008980896 274 TIYLgirsrqsg-------------------endrwrfyW--KMVYEYADVSMLHLLATFLESAPQLVLQLCIIVQThsL 332 white-tufted-ea...
AAU94452     120 ALIVyfkagkkeetyvtlsrk-islkkgqkipteweigqSerTLAAHRNAFKRTAVIQAFLGSVPQLTLQMYATIQE--K 196 spotted green p...
XP_005992052 116 SLVVyyragrkeepyvsitrk-kqlkkgcereveqevghSlrKLATHRNAFKRTAVIQAFLGSTPQLTLQLYVSVME--E 192 coelacanth
Q5GH21       112 ALTVyctmgreeepyvsisrkkklqgwgeaeeeerevghSlrRLATHRNAFKRTAVVQAFLGSTPQLTLQLYVSVLE--R 189 tropical clawed...
XP_004940756 102 ALVVycwsgqeeepyvtitrk-rrlrkgyeveleqevghSvrRLATHRNAFKRMAVIQAFLGSTPQLTLQLYISILE--K 178 chicken
XP_002719876  86 AFCIycqsshneepyvsitkkrqipknglseeiekevgqAegKLFTHRSAFSRASVIQAFLGSAPQLTLQLYISVLQ--Q 163 rabbit
XP_001514150  86 VFCIyfhegeveepyvsitrkrqipkngyseeierevgqAegKLCTHRSAFSRASVIQAFLGSAPQLTLQLYISVLQ--Q 163 platypus
XP_003218964  86 VFCIyfqagrveepyvsitkkrqmpkdghsdeiekevgqAegKLFTHRSAFSRASVIQAFLGSAPQLTLQLYICVLQ--Q 163 green anole
NP_001027881  86 AFCIygsvgrveepyvsitrkkqiprggqceeverqvgqAegKLFTHRAAFARTSVIQAFLGSAPQLTLQLYICVLQ--G 163 torafugu
XP_029702972 118 ALIVyfnavnkeeayvtlsrk-iilkkgrkilvewetgrSerTLAAHRNAFKRMAVIQAFLGSVPQLTLQMYATIQE--K 194 torafugu
XP_008980896 333 QA--LQGFTAAASLVSLAWALASYQKA-LRDSRD-DKKPISYMAVIIQFCWHFFTIAARVITFALFASVFQLYFGIFIVL 408 white-tufted-ea...
AAU94452     197 YApsARLALMIINLVSITYGALVCNVLaIHIRYDdYKVRVRPAAYLCMTVWRGLEIATRITVLVLFSTALKYWVVLVGSL 276 spotted green p...
XP_005992052 193 TIlpERVALMVISLLSVTYGALVCNVLaIQIKYDdYKIQLKFTSYLCIILWRSLEIATRVTVLILFCTALKIWILPVVLV 272 coelacanth
Q5GH21       190 NVppARAVLMAMCLASTTYGALILNVLaIQIKYDdYKVRLSVPAFLCIVMWRCLEIATRVTVLVLFCSALKAWVAAVALA 269 tropical clawed...
XP_004940756 179 YVpvTRAILMGICLVSVTYGALVCNVLaIQVKYDdYKVQLRPLAFLCIVLWRSLEISTRVAVLVLFSTVFKHWIIPIALA 258 chicken
XP_002719876 164 HVtvGRCFLMTLSLLSIVYGALRCNILaIKIKYDeYEVKVKPLAYVCIFLWRSFEIATRVTVLVLFTSVLKTWVVAVILL 243 rabbit
XP_001514150 164 EVtiGRSIFMSICLLSIVYGALRCNILaIKIKYDdYDITVKPAAYICIFFWRGFEIATRVVVLVLYSSVLQIWILPVVLL 243 platypus
XP_003218964 164 EItaARSIFMTLSLLSIVYGALRCNILaIKIKYDdYDVNIKPMAYLCIFLWRSFEIATRVIVLVLFSSVLQIWTLPVVLV 243 green anole
NP_001027881 164 GVsvGRGTLMVISLLSIVYGALRCNILaIKIKYDdYEVDIRPMAYLCIFLWRSFEIATRVAVLVLFSSVLQLWVLPVVLL 243 torafugu
XP_029702972 195 YImpARLVLMIINLVSITYGALVCSVLaIHIRYDdYKVRIRPAAYLCMTAWRGLEIATRVTVLVLFSTALTHWVILVGMA 274 torafugu
XP_008980896 409 HWCIMTF--WIvhCETEF------------CITKWEEIVFDMVVGIIYIFSWF----------N-VKEGRTRCRLFIYYF 463 white-tufted-ea...
AAU94452     277 NLLFFFFqpWTefWAKKGsltqglernfshFGTVVVLSLFTLLYACINVFCWSavqld-fthrElIQRRQGWGRLALYYC 355 spotted green p...
XP_005992052 273 NMLTLFFlpWVrfWRSKAsfpenieknfskVGTTVVLSMVIFLYASINMFCYSavqln-lsdrDlIDKAQNWGRLALYYT 351 coelacanth
Q5GH21       270 NLLALFLlpWVkfWSSGDslpqnieknfswFGTVTVLGSVTLLYSAINMFCWSavqln-lsdrDlIDQSQNWGRLSLHYT 348 tropical clawed...
XP_004940756 259 NLLVVFFqpWVqfWRSGTrlpdnieknfsrVGTVVVLFAFTLLYASINMFCWSavqlkladrdL-IDKSQNWGRLAVYYV 337 chicken
XP_002719876 244 NFFSFFLypWIlfWCSGSpfpeniekalsrVGTTIVLCFLTLLYTGINMFCWSavqlk-idnpElISKSQNWYRLLVYYM 322 rabbit
XP_001514150 244 NFFGFFFypWIlyWHSRSpfpenvekamsrVGTSVVLFLLTFLYAGINMFCWSavqlk-indpDlINKSQNWHVMAVYYL 322 platypus
XP_003218964 244 NFFAFFFhpWIlfWQSKCtlpeniekalskVGTTIVLCLLTFLYAGINMFCWSavhlk-lndaDlIDKSQNWCRLALYYL 322 green anole
NP_001027881 244 NFLVFFLypWIlfWLSHSpfpeniektltrVGTTIVLCLLTFLYAGINMFCWSavqvk-lndpDlINKSQNWYRMAVYYM 322 torafugu
XP_029702972 275 NLLFFFFlpWAefWAKKGsltqgvernfsnFGTVVVLTLFTLLYACINVFCWSavqldfthreL-IQRKQGWGRLALYYC 353 torafugu
XP_008980896 464 VILLENTALSALW-YLYKApqiaDAFAIPALCvVFSSFLTGVVFMLMYYAFFHPN 517 white-tufted-ear marmoset
AAU94452     356 ARFVENFVLITLWyFNKSDffeyVCAPLLVVQ-LLIGYSMSVLFMLVFYQFCHPC 409 spotted green pufferfish
XP_005992052 352 VRLLENTGLILLWyFFQTDvhenICTPLLVLQ-LLAAYCLAIFFMLIFYQYCHPC 405 coelacanth
Q5GH21       349 IRLLENAALILLWyFYKEDvfeyFCSPLLVVQ-LLVGYATAIFFMLLFYQYLHPC 402 tropical clawed frog
XP_004940756 338 ARLLENTALVVLWyFFKTDvyenICTLLLVVQ-LLLGYCLAIYFMLLFFQYLHPC 391 chicken
XP_002719876 323 MRFIENATLLLLWyFFKTDiymyVCAPLLVLQ-LLVGYCTAILFMLVFYQFFHPC 376 rabbit
XP_001514150 323 LRFVENAFLLLMWyIFRTDiymyVCAPMLIVQ-LLVAYCLAILFMLGFYQFCHPC 376 platypus
XP_003218964 323 LRFLENAFLLLMWyMYKTDvytyVCAPMLFLQ-LLIGYCIAVLFMLAFYQFCHPC 376 green anole
NP_001027881 323 LRFVENASLLLLWyVYKTDfyklICAPLLVLQ-LLVAYAIGIFFMLVFYQFCHPC 376 torafugu
XP_029702972 354 GRFVENLVLITLWyFYKSDfyekVCTPLLVVQ-LLICYSLSVLFMLLFYQFCHPC 407 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap