Conserved Protein Domain Family
CDK2AP

?
pfam09806: CDK2AP 
Cyclin-dependent kinase 2-associated protein
Members of this family of proteins are cell-growth suppressors, associating with and influencing the biological activities of important cell cycle regulators in the S phase including monomeric non-phosphorylated cyclin-dependent kinase 2 (CDK2) and DNA polymerase alpha/primase. An association between mutations in the gene coding for this protein and oral cancer has been described.
Statistics
?
PSSM-Id: 370710
View PSSM: pfam09806
Aligned: 10 rows
Threshold Bit Score: 135.35
Threshold Setting Gi: 195046152
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001992100          1 MDIMDIQAVESKLSDVTVTPIP--------RSQVQNFYNyQQQREQREQQPQIQISAIHHSRG--------------SNn 58  Drosophi...
Q9VZ27                1 MDIMDIQAVESKLSDVTVTPIP--------RSQVQNFYNyQQQREQREQQPQIQISAIHHSRG--------------SVg 58  fruit fly
Q29HL4                1 MDIMDIQAVESKLSDVTVTPIP--------RSQVQNFYNyQQQREQREQQPQIQISAIHHSRG--------------NSs 58  Drosophi...
WGS:AAPP:GF15097-PA   1 MDYVDIESFRSKYSDITVTAVPtrskrleeAPVEPE----TKASVTKQQEPRVEITRVPGAPG--------------SS- 61  Drosophi...
Q9VJC8                1 MDYLDIESFRSRYSDITVTAVPsrpkadeePAMDTN-----QELAIKTHVPQVEITRVSGAAS--------------AG- 60  fruit fly
EDW04122              1 MEFTDLETFRSKYSDLTVTAVPakrqkldaQ---PENLD-AAKHVEKSPTALVEIIPIIASNA--------------AA- 61  Drosophi...
WGS:AAPU:GI22388-PA   1 MDYLDLDSFRSRYSDITVTAVPakpqaveeQETLPDCCDvAGGGAEMMPADRVEIFPISMSSA--------------PG- 65  Drosophi...
WGS:AANI:GJ20285-PA   1 MDYLDLDSFRSRYSDITVTAVPakrqktdgQDEPPEAWD-AAGSSEKAPAARVEIIPITLPNG--------------AA- 64  Drosophi...
XP_002066313          1 MDFLDIESFRSKYSDITVTAVPsggnsstnCNVQKDGDPsMDEPLLVEEPPRVEITRVEVVGG--------------SN- 65  Drosophi...
XP_001357063          1 M---DLESFRSKYSDLTVTALPpggkkkesTKANEED---IKMATVEEKPPRVEITRVSSGNGtaygpptstflggsSSf 74  Drosophi...
XP_001992100         59 stnsgsntgnnsninnnnnsnnnnnmvaTDYATNSssssglggggGGGSKRDRNS-------VTQSSAAATAAA---AAA 128 Drosophi...
Q9VZ27               59 ggggs-----------------nssnaaTDYSTSS----------GGKRERDRSSasdysssSSKQSSAAAANAaaaAAA 111 fruit fly
Q29HL4               59 nsgsagssg----------nnsmggmgaTDYSTSSgs------gnANSNKRDRSAdys--tsSKQNSAAANAAA---AAA 117 Drosophi...
WGS:AAPP:GF15097-PA  62 ----------------------------SSGTPTS----------TAMMQRSKQQ----------QNAAALAYAneyKEV 93  Drosophi...
Q9VJC8               61 ----------------------------SSSTANA-----------AMMLRNRQQ----------TNSAALAYAneyKEV 91  fruit fly
EDW04122             62 ----------------------------STFQQSS----------KRITKQEQQQlqfqqqqQLQQAEDDVAYSneyRQV 103 Drosophi...
WGS:AAPU:GI22388-PA  66 ---------------------------------NS----------MVMQQQHPHQle---eqQLKLNQEAAAYSneyQQV 99  Drosophi...
WGS:AANI:GJ20285-PA  65 -----------------------------PTEQCS----------KSMQQQQQHQqk---qqQQQFTQDALAYSneyQQV 102 Drosophi...
XP_002066313         66 ----------------------------GGGHGSV----------PPPQTSNEMD----------LKNAATAYAmeyKQV 97  Drosophi...
XP_001357063         75 saggpahgpssgvfasnhrggsilepspSTPADGS----------GSLRTRSRQQ-----------TAAALAYAceyKQV 133 Drosophi...
XP_001992100        129 VAALQYSpQFLQAQLALLQKQSnttATPssasasaaAAAAAAALSLANiaaASnggRSSininsinninnsnssnintns 208 Drosophi...
Q9VZ27              112 VAALQYSpQFLQAQLALLQQQSnttATP--------AAVAAAALSLANmcsSNggqRNSgagvsstssgsngqsmglnls 183 fruit fly
Q29HL4              118 VAALQYSpQFLQAQLAMLQQQSnttATP--------AAAAAAALSLANiaaATngaRNSgnsngnnqglnltqsql---- 185 Drosophi...
WGS:AAPP:GF15097-PA  94 MAKLEYT-RYMQAKIQLMAMASgvgSGAgagmdgslYGMMPTAITVDA-------------------------------- 140 Drosophi...
Q9VJC8               92 MAKLEYT-KYMQAQLQIMSAANg--GGGgfgidsdlFG---TSIGLDE-------------------------------- 133 fruit fly
EDW04122            104 LAKLEYT-KYAQAQLQLMSASN---------------GIAGNSYDSNDiggNSy-dSNG--------------------- 145 Drosophi...
WGS:AAPU:GI22388-PA 100 LAKLEYT-KYVQAQLQLMSNNNgfg--------elfYGLPGNQIQVPS---NEadnSGN--------------------- 146 Drosophi...
WGS:AANI:GJ20285-PA 103 LAKLEYT-KYVQAQLQLMSSNN---ALGscafgellYGLPGSNMQLPS---AE---SNG--------------------- 151 Drosophi...
XP_002066313         98 MDKLEHT-RYLQAQLQLLTLAN-----GgrvldnglFDLIPSGIANDP-------------------------------- 139 Drosophi...
XP_001357063        134 MAKLDYT-KFMQAKLKQLSASQgq----------nnAGAAHNSVMTSEkivva--------------------------- 175 Drosophi...
XP_001992100        209 sssnlglnltqsqlkypppstspaivttqtSANIttpltstanlptvgslsvgngLTKYAQLLAVIEEMGRDIRPTYTGS 288 Drosophi...
Q9VZ27              184 ----------ssqlkypppstspvvvttqtSANIttpltstas---lpsvgpgngLTKYAQLLAVIEEMGRDIRPTYTGS 250 fruit fly
Q29HL4              186 --------------kypppstspvvvttqtSANIttpltstanlptvgslstgngLTKYAQLLAVIEEMGRDIRPTYTGS 251 Drosophi...
WGS:AAPP:GF15097-PA 141 ------------------------------NANI---------------------EDKYSDLLRLLAEMQPNLAPTMMGL 169 Drosophi...
Q9VJC8              134 ------------------------------NANI---------------------VDKYSDLLNVLGEMRTNVPTTMAGL 162 fruit fly
EDW04122            146 ------------------------------TSNI---------------------VDVYDNLLSVIAEMQSCLGPTAMGL 174 Drosophi...
WGS:AAPU:GI22388-PA 147 ------------------------------SGNI---------------------VDTYDNLLRVIAEMHRNLGPTAIGL 175 Drosophi...
WGS:AANI:GJ20285-PA 152 ------------------------------TTNI---------------------VDTYDNLLAVIGEMQSNLGPTAIGL 180 Drosophi...
XP_002066313        140 ------------------------------TANI---------------------VDKYSNILATLASMKMEISPTLMGA 168 Drosophi...
XP_001357063        176 --------------------------dedvQGNI---------------------VDTFDNLVSVVGKMKAVLNPTVMGM 208 Drosophi...
XP_001992100        289 RSSTERLKRGIVHARILVRECLMETERAAR 318 Drosophila grimshawi
Q9VZ27              251 RSSTERLKRGIVHARILVRECLMETERAAR 280 fruit fly
Q29HL4              252 RSSTERLKRGIVHARILVRECLMETERAAR 281 Drosophila pseudoobscura
WGS:AAPP:GF15097-PA 170 RAPKERLQRDIAHARVIVRECLLILERDQQ 199 Drosophila ananassae
Q9VJC8              163 RAPKERMQRDIAHARLKVRQCLQLLQQAEE 192 fruit fly
EDW04122            175 RAPKERLLRDIGHARVLVRECILmlmhnq- 203 Drosophila grimshawi
WGS:AAPU:GI22388-PA 176 RAPKERLLRDIAHARVLVRECILMLMRDHR 205 Drosophila mojavensis
WGS:AANI:GJ20285-PA 181 RAPKERLLRDIAHARVLVRECILMLMRDhq 210 Drosophila virilis
XP_002066313        169 RGPRERLLRDIAHARILVRECIMLIERDQQ 198 Drosophila willistoni
XP_001357063        209 RFASERMLHEITNARLVVKTGQIILKREEL 238 Drosophila pseudoobscura pseudoobscura
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap