6ND1


Conserved Protein Domain Family
Sec66

?
pfam09802: Sec66 
Click on image for an interactive view with Cn3D
Preprotein translocase subunit Sec66
Members of this family of proteins are a component of the heterotetrameric Sec62/63 complex composed of SEC62, SEC63, SEC66 and SEC72. The Sec62/63 complex associates with the Sec61 complex to form the Sec complex. Sec 66 is involved in SRP-independent post-translational translocation across the endoplasmic reticulum and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. Furthermore, Sec66 is also required for growth at elevated temperatures.
Statistics
?
PSSM-Id: 401672
View PSSM: pfam09802
Aligned: 61 rows
Threshold Bit Score: 167.739
Threshold Setting Gi: 667785738
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ND1_E        27 SISVYTPLIYVFILVVSLVMFASSYRKKQAKKISEQPSIFDENDAHDLYFQIKEM----SE--NeKIHEKVLKAALLNRG 100 baker's yeast
EAZ63011      15 RISVFTPLIYVAILLGVFIVFSIRYRRNRLNKLVSIEPIFPDNQPAKIYESLKQSaadpNVakEnKPHDKVLKAALLRRG 94  Scheffersomyces...
CCE87251      11 KISVFTPIIYVGVLLSSFIAFSIIYRKRRLEKLVSADTLFSENHAQNLYEFLKEQyndpNAssDtKPHLKVMKAALLRRG 90  Millerozyma far...
Q6BRF8        12 KISIYTPLIYVGVLLTCFIAFSIIYRRKKLNKLTKVEPIFSDNHTLNLYLFLKQQynnpEAtaEtKPHTKVMKAALLRRG 91  Debaryomyces ha...
Q5A647        14 KISVFTPLIYVGVVLSIFITFSIIYRKRRLQSLTKVEPLFKENYTAVLYQHLKDQytnkDLpkDqRPHEKVMKAALLRRA 93  Candida albicans
XP_007373032  14 KISVFTPLIYVGVVLSVFVAFSIIYRRRRLNTLRQTEPLFKENYNAILYQNLKEQyhnqNIpkDqRPHEKVLKAALLRRA 93  Spathaspora pas...
EEQ39712      12 RISVYTPLIYVAVMATAFVAFSVFYRRHRLRKLIEVEPLFGRNYSLELYILLKDKfynkSLpkEgRPPEKVVKAALLRRA 91  Clavispora lusi...
EDK36526      40 KISVVTPLIYVGVLLGAFVMFSIFYRRNKIQKLAEIEPIFKENHPASLYAFLKSQyvdpEVpkDqKPHEKVMKAALLRRG 119 Meyerozyma guil...
EGV60985      11 NISVFTPIIYLCILLSCFIAFSVIYRRRRVNNLAKVVPIFEENHSANVYAFLNSQysdpELpkDqKPHEKVMKAALLRRG 90  Yamadazyma tenu...
XP_011273055  16 KISVFTPIIYVTVVLTALVVFSINYRKNKINALYNRQPFFKRNLPKELHFELRDS--------DpKPNEKVLKAALLRRG 87  Wickerhamomyces...
6ND1_E       101 AESVRRSLKLKELAPQINLLYKNGSIGEDYWKRFETEVKLIELEFKDTLQEAERLQPGWVQLFVMVCKEICFNQALSRRY 180 baker's yeast
EAZ63011      95 AEAIRRSMKLKENEPIFNKLYEDGLIGDDVYKQFQIQAKLQEIELKEIVQECETYKKGWVQTFFPTVQEICFNEALRRRL 174 Scheffersomyces...
CCE87251      91 AEAIRRSLKLKENEPIFNRLYQEGHIGDATFKSFTISTKLQEIEIRDIVIEVENMKKGWTQQFFATCQEICFNEALRRRL 170 Millerozyma far...
Q6BRF8        92 VEAIRRSLKLKENEPIFNKLYQEGLIGDDVFKNFQIQAKFQEIELKEIVQECETYKKGWVQQFFPVAQEICFNEALRRRL 171 Debaryomyces ha...
Q5A647        94 VEAIRRSMKLKENEPVFNKLYQNGLIGDDIFKQYQIQIKFQELELKDIVTECETYKKGWVQTFFPLAQEICFNEALRRRL 173 Candida albicans
XP_007373032  94 VEAIRRSMKLKECESIFNKLYQNGLIGDEIFKQYEIQLKFQELELKEIVQECESYKKGWVQTFFPVAQEICFNEALRRRL 173 Spathaspora pas...
EEQ39712      92 VEAIRRSLKLKENEPVFNKLYQEGLIGDELFKQFGLQSKIQQLELKEIVEECQQFSKEWPATFFPVAQEICYNEALRRRL 171 Clavispora lusi...
EDK36526     120 VEAIRRSLKLKENEPIFNRLYQEGLIGDDVFRQFEFQAKFQEIEIKQIVQECESYKKGWAQSFFPVAQEICFNEALRRRL 199 Meyerozyma guil...
EGV60985      91 VEAIRRSLRLKEAEPVYKTLYQDGLIGDDVFQQFNIQLKLQELEINEIVQQCESFKKNWAQSFFKVAQEICFNEALRRRL 170 Yamadazyma tenu...
XP_011273055  88 AESIRRTIKLKEVQPFITALYQKGSIGDDLYERYQTATKLEELEVQEIVAETEKYKAGWIPKFVPLLQEICFNEALRRRY 167 Wickerhamomyces...
6ND1_E       181 QSILKRKEVCIKEWELK-IN 199 baker's yeast
EAZ63011     175 SAIDSRSEEYAKLWEYL-VD 193 Scheffersomyces stipitis CBS 6054
CCE87251     171 NALDERHSVLSELWEYTdKD 190 Millerozyma farinosa CBS 7064
Q6BRF8       172 NSMDERSKNLSDLWQYY-VE 190 Debaryomyces hansenii
Q5A647       174 KASDDRAETFSKLWETY-AD 192 Candida albicans
XP_007373032 174 KAMEGREEALAELWQCF-VE 192 Spathaspora passalidarum NRRL Y-27907
EEQ39712     172 HAMDDRSKSLSELWNYY-VD 190 Clavispora lusitaniae ATCC 42720
EDK36526     200 NAMTERGNSLAEVWGYQ-VD 218 Meyerozyma guilliermondii ATCC 6260
EGV60985     171 YSMSERKVDLSEVWEYY-AD 189 Yamadazyma tenuis ATCC 10573
XP_011273055 168 SAIEDRKLDLLDQWEIK-IS 186 Wickerhamomyces ciferrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap