5X6O


Conserved Protein Domain Family
LCD1

?
pfam09798: LCD1 
DNA damage checkpoint protein
This is a family of proteins which regulate checkpoint kinases. In Schizosaccharomyces pombe this protein is called Rad26 and in Saccharomyces cerevisiae it is called LCD1.
Statistics
?
PSSM-Id: 401670
View PSSM: pfam09798
Aligned: 28 rows
Threshold Bit Score: 246.461
Threshold Setting Gi: 6174941
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5X6O_G        77 MLRDKINFLNIEREKEKNIQAVKVNELQVKHLQELAKLKQELQKLEDEKKFLQMEARGKSKRevitnvkppsttlstntn 156
EMG49723      74 tLRAQLLQLQNQKQQEITELKQTYDTLKQTSEEQMLNLKNTVQRLEDEKKFLNNELISTTA------------------- 134 Candida maltosa...
XP_002549810  70 tLRAQLLQLQNQKQKEVADLKDTFNTFKQSTEDQVASLKNTVQRLEDEKRFLSNELITTND------------------- 130 Candida tropica...
XP_001528384 127 tLQAQLLQLQNQKRDELNDLRQAYEALKKSKDAETEALKEAVHKLEDDRKFLKNELITSNA------------------- 187 Lodderomyces el...
CCE43149      86 tLKAQLISLQNAKRDELNTLRQSYDAFKKSKEEEAAALRDVVLKLEDDRKFLKNELVTTNA------------------- 146 Candida parapsi...
ABN64347      36 ILRAQLEQLQKQNQKEIHQLRDQKDQLYRQNEDQVNVLKHAVQKLEDEKKFLNNELKTTTH------------------- 96  Scheffersomyces...
CCE87077      70 ILRAQLDLLQRQKHDEIKQLVDAQEASRLRDEEKMQALKFTIQRLEDEKRFLNNEVRNLAS------------------- 130 Millerozyma far...
EDK39210      63 ILRAQLEQLQNSSRDELAKLRETLALEKHNKDGQVESLRAAVQSLEDERKFLNNELRATSVA------------------ 124 Meyerozyma guil...
Q6BPF5        66 ILRAQLQQLQNQKQEDLNKLKESHNISKVQNDEQLKALKFTVQKLEDERKFLNNELRGATA------------------- 126 Debaryomyces ha...
EEQ38026      37 ILRAQLEALQSSKNAEAERLRRDLEAARSAARGHIDALKSSVDKLEDEKRFLDNEIRALS-------------------- 96  Clavispora lusi...
5X6O_G       157 titpdsssvaieakpqspqSKKRKI--SDNL------------------------------------------------- 185
EMG49723     135 -------------------VKRRKV--TTTdtpntttfveshstppppapvpaqappqpqqpptpnqteptqlttqydyk 193 Candida maltosa...
XP_002549810 131 -------------------LKRRKIvqnkvtppvvsnsphnedsiiee---------pvisvqpnneisivssepeitvk 182 Candida tropica...
XP_001528384 188 -------------------LKKRKIvlTQEDgllatmgttngnttvnasg-----------maetpptsvatdvevirek 237 Lodderomyces el...
CCE43149     147 -------------------LKKRKI--NGNDntnssqqtrpqvstemdq--------------svfeaslesegtsipsq 191 Candida parapsi...
ABN64347      97 -------------------NKRRKL--TPPVierqppshstplspsq-----------------lsmegsassvelphkh 138 Scheffersomyces...
CCE87077     131 -------------------FKRRRV--DSGRsedlstttespvskvsrs--------------sgtqshsetsenssrsv 175 Millerozyma far...
EDK39210     125 -------------------LKRRKV--GESQtanitfsgtmgattlatpstqskspaiskqknssnsgqyrvpesdtrpl 183 Meyerozyma guil...
Q6BPF5       127 -------------------LKRRKL---PSRaddsmmdidvmpildtqqang--------tryqheraesiepetelrpi 176 Debaryomyces ha...
EEQ38026      97 -------------------AKRRKV--EAAEsrpqsrpaklssae----------------------sspaeqpevdvrp 133 Clavispora lusi...
5X6O_G       186 LKKNMVPLNPnriipdETSLFLESILLHQIIGADLSTIEILNRLKLdyITEFKF--KNF---VIAKGAPIGKSIVSLLLR 260
EMG49723     194 PVQKIIKLQN------DSSLLIDQLWNNSIIGSSRTSFEYLSKICL--DFDLELn-SGL---VILKQTSISSSIVEFLMI 261 Candida maltosa...
XP_002549810 183 PIQKIIKLQN------DSSLLIDQLWNHSIIGSKRTSFEYLSKICI--DMDLTLs-SGL---KIVKRTSLSSGIVEFLMI 250 Candida tropica...
XP_001528384 238 VVQKIVRVEN------DTVVFIDHLRKYIMLGTNRSSFSFLNKICF--DSDLDFnfETMsktQIKKQQAISPVLLDAIMN 309 Lodderomyces el...
CCE43149     192 TIQKVIRVQH------ETSALIDQIWRYCIPGSKRSTIEYLSKICF--NFDI----DTLygyKLEKKTAIASFISNVLMS 259 Candida parapsi...
ABN64347     139 LAQQIFQQQQ------TSALYTDHIWNHCIVGSNRTSLSYLGKISI--HFDVVV--GDL---SLVKREPLSRSIVDYMML 205 Scheffersomyces...
CCE87077     176 LAQRVIKIQN------DSSLFTDHIWSHCINGSRRSTLKYLSKICL--DDDIQF--DGF---KVNAKMPVSTAITEYLML 242 Millerozyma far...
EDK39210     184 VPQKVIKIDN------DASLLEDHLWNHCINGTKRTTVSYLSKIYL--DRDVRI--RDF---VLHKKQPISTAVTEFLMV 250 Meyerozyma guil...
Q6BPF5       177 LPQKIIKIQN------DASLFTDHIWNHCINGSKRSTLNYLSKIYV--DIDILV--HDF---KTHAKMPLSTAITEYLML 243 Debaryomyces ha...
EEQ38026     134 GDGVVIRVQD------EWSQFCDYLHGYTINGSSRTCMGFLATICV--EESVGSsgFGRr-lRLAPRVPVSSAVWEYLLE 204 Clavispora lusi...
5X6O_G       261 CKKTlTLDRFIDTLLEDIAVLIKEIS-VHPNESKLAVPFLVALMYQIVQFRPSATHNLALKDCFLFICDLIRIYHHVLKV 339
EMG49723     262 NKNN-RLDKLIEIFTLSLIQLVERLL---KQKSILSIPFLLSLIHCSISFRPAALTKALITQLLKRVSKITEGLSFLLNS 337 Candida maltosa...
XP_002549810 251 NKNN-RLDKLVENFTLSLIQLIEKLL---KSKSILSVPFLISLIHCSINFRPAALTKSLISQLLKRVSKIAEGWAFLLDS 326 Candida tropica...
XP_001528384 310 LREN-RLDDMIDKVNTLLMNIIEKSI---QNDLILPVPFLVSLMHCSLTFKSAAVTERLIKKLVVWLSDFAAKYVYLLSP 385 Lodderomyces el...
CCE43149     260 MKAA-RLDELIEKLSLLVLDIIRQVV---AQKATLSVPFLLSLIYCTISFRPVAVTKPVIIKLIHDCCELAMSYTFLLNP 335 Candida parapsi...
ABN64347     206 KKSL-RLDELVEDFCLSIAEVVDILL---EKKAILAIPFLLSLVHCSIAFRPAAITPNLIVKLLQRFSRISNNLSFLLSS 281 Scheffersomyces...
CCE87077     243 KKSL-RLDDLISDFCVTLCTFVEILV---SRKSVLAVPFVISLIHGALSFRSSAVSRDLIKKLLTSLCTIVSDSVFLLDS 318 Millerozyma far...
EDK39210     251 KKAL-RLDSLIHEFSLTMCELVEDII---AHQILTSVPFLLSLVYASLIFRSSALNKETIQLLVPKICSIAVDFAFLLDS 326 Meyerozyma guil...
Q6BPF5       244 KKNL-RLDELVAEFTQTLSDLVDILL---EKKLILSIPFLLALIHASLNFRSSAVSQTSIKSLLESICKLALNFTFLLDS 319 Debaryomyces ha...
EEQ38026     205 VRHL-RLDMLVENVCGELMALVEALLaVPQQRAFLAVPFLVCLVHASVTFKYSAVGEKLALQLVQQACALSRRFVALLVS 283 Clavispora lusi...
5X6O_G       340 PIH-------ESNMNLH-VEpqiFQYELIDYLIISYSFDLLEGILRVLQSHpkqtymeffDENILKSFE-F--VYKLALT 408
EMG49723     338 NLDe------dDLANYHdVP---YQIMVLEKFIFTSCLDLVERLVTLSTIFd--------EPQFVKKIW-QnhILSESLI 399 Candida maltosa...
XP_002549810 327 NLDe------dDLANYHeVP---YQVMVLEKFIFTCCLDLIERLVTVSTIF---------EPDFIKAIW-QkqILSQTLV 387 Candida tropica...
XP_001528384 386 DLEe-----eSRIGIHSeKP---LQVTALEKFLLIQLVDTLEKVVILASGF---------GAKFLTSVWk--iSLMVSLV 446 Lodderomyces el...
CCE43149     336 NLEe-----eADFGNYHdVP---DQVIAIERFILICCLELIEKLTVISSIY---------DADFIRQVWtDqtVIPKALV 398 Candida parapsi...
ABN64347     282 NLNe------eDYVNYHdVP---NQVMILEKFIFICCLDIIEKLTSVSSLH---------GSNFIKSVW-KddVLSIELL 342 Scheffersomyces...
CCE87077     319 TQDe------nDIVHYHdVP---RQVMVLEKFALICALDTVEKLMVIASQF---------DQSFIKSLW-DedYLSLNLL 379 Millerozyma far...
EDK39210     327 SQDq------dDIINYHnVP---LQVMVLQKFSLICCFDILERILYVATVF---------DTEFSSGLW-Qe-PQMVQLF 386 Meyerozyma guil...
Q6BPF5       320 SQDe------eDFINYHdVP---NQVMVLEKFALICCLDIIEKLMSLSSLF---------GAKFIETIW-KenYVRVELF 380 Debaryomyces ha...
EEQ38026     284 ADGadsfveqRGT----------YQQRVLENFTLVACLDLVEAVVVVATQF---------GAAFVRRLW-H--TMDFDLL 341 Clavispora lusi...
5X6O_G       409 ISYKPM----------VNVIFSAVEVvniitsiilnmdnssdlksLISGSW---WRDCITRLYALLEKEIKSG--DVYNe 473
EMG49723     400 TSCLPEnserfkntaqINAVFNIVEM-------------------LIASVSettFGFNETKT----DESIISSllKIFLi 456 Candida maltosa...
XP_002549810 388 KSCLPEnserfkntvqINAVFNIVEM-------------------LGASITedtFAFNETKL----DESIISSllKVFLi 444 Candida tropica...
XP_001528384 447 NTLLPQnterfksiaqINTVTSIVGL-------------------TASSVAeegFTFNSVKT----ETSIVSAliKVLTf 503 Lodderomyces el...
CCE43149     399 TSCLPQnverfkstaqINLVFNVVEI-------------------LLASITedtFGFNEAVS----DFNMISSlmRIFLi 455 Candida parapsi...
ABN64347     343 NRCLPEnterfknsaqINVVYNIVEM-------------------LISSTTddtFAFSDVANAKVSDSSIFNSllKIFLi 403 Scheffersomyces...
CCE87077     380 RSCLPEnterfknvsqINVIFNFIEI-------------------LASSLTesgFAYNNVKS-KASNESIINSllKIFLi 439 Millerozyma far...
EDK39210     387 KFCLPEnserfmnttqSNLVYSVVEM-------------------LISSITesgFAFDNQPV---KNDAIVSSllKVFLi 444 Meyerozyma guil...
Q6BPF5       381 RKCLPEnterfknlaqINLIYNFVEI-------------------LMSSISettFAYNDTPN-KILDESIINSllKVFLi 440 Debaryomyces ha...
EEQ38026     342 TAVFPEnserfkasaqINLVYNYVEM--------------------LSASLeggFAAGDQAQ----NARIVQSliKAFLi 397 Clavispora lusi...
5X6O_G       474 nvdtttLHMSKYHDFFGLIRNIGDNELGGLISKLIYT------DRLQSVPRVISKEDIGMds---------------dkF 532
EMG49723     457 -----eIPLRQDFMFYGLNRILGNNHDFIKVDSVIPVqhdylnNYLVSIPQPIPYNITEP-------------------- 511 Candida maltosa...
XP_002549810 445 -----dIPLRQDFMFYGLNRILGNNLDFLKINSMIPVdrdhlnNYLVVLPQPIPFNMAIP-------------------- 499 Candida tropica...
XP_001528384 504 -----dLLVKNGFHFYGLNRILGNNSDMQKIELAVPRehdrlnNYLVTIPPPIHLNLFSQd-----------------pQ 561 Lodderomyces el...
CCE43149     456 -----dVPIKDGFRFYGLNRFNGNNYDLKVIDLTIPIkhdnlhNYLVSIPQPVYKNLDSD-------------------L 511 Candida parapsi...
ABN64347     404 -----eLPIKDDFMFYGLNRVIGNNIDFRKIDATIPQtadilnNFNILIPQPIPFNLIKEnqs--------------neS 464 Scheffersomyces...
CCE87077     440 -----eLPIKEDFMFYGLNRVVGNNFDFDKIESIIPAtetilkHSMISIPGPIADDVLEEkgfmrqdttggsenpssesH 514 Millerozyma far...
EDK39210     445 -----dIPIKEDFKFYGLNRVLGNNSDLSKVEATVPEsetllqESMVLIPCPIPQTMQQE-------------------- 499 Meyerozyma guil...
Q6BPF5       441 -----eLPVKDDFMFYGLNRIMGNNIDFNKIDSIIPTsetllnHSMISRPCPIPYEYLQErmvpikkesnltskdsqmnQ 515 Debaryomyces ha...
EEQ38026     398 -----dISVKDDFMFFGLNRALGNNGDLVKICEAVPQenp-lnTPLVSVAFPVKHTPPSP-------------------Q 452 Clavispora lusi...
5X6O_G       533 TAPIIGYKMEKWLLKLKDEVLNIFENLLMIYGDDATIVNGEMLIHSSKFLSREQALMIeryVGQDSPNLDLRCHLIEHTL 612
EMG49723     512 SQFEINMNHEYHLLTLRIKVAELLLSLIITKQTVDFLYSKDHFKSLIRVIGFEQNYIA---RSPRSKHIYLRLQIIAILV 588 Candida maltosa...
XP_002549810 500 SKFGIDMNHEYHLFTLRIKVAQLLLGLIITKQTFDFLYKKEHFKSMIRVIGFEQNYIA---RNPRSKHVHLRLQLIAILV 576 Candida tropica...
XP_001528384 562 TFGFSHEKYETHLLHLRIQVAHLFLTWIITKQSVSMLRDRDHFKSLFRVIGIHQSYVA---NNVRSKHVGLRIQLIALLV 638 Lodderomyces el...
CCE43149     512 NQKEIQLHHEAHLLNLKIKVCELFQSLIISKQTIDFLIDKEHFKSFVRIIHFEQTYMA---NDPRSPTLHSRVHLIGQIV 588 Candida parapsi...
ABN64347     465 IRFELLSNHEFHLLNLRIKVADLLESYIVAKQSVEFLMSREHVKSIMRIINFEQMYIM---RSPRSKYIHLRIQIVSKLV 541 Scheffersomyces...
CCE87077     515 LCFELSKLHEIHLLHLRLKVTSLLESYVMTHLSTKVLESKECLKSIIRTIGLEQNFIM---KLPRSDTVPMRIQIIASLV 591 Millerozyma far...
EDK39210     500 SAVTVETNHELHLLYLRLRVATMIEGHIVTKGSTQLFQDKEYLKSIVRYIGLEQGLIM---NSPRAPTVHIRVRIISTLV 576 Meyerozyma guil...
Q6BPF5       516 LAFEVQSNHEYHVLDLRLKVATLLESFIVTKSSTQIFELKEYIKSIVRTIGFEQVFIM---RSPRSKTIYLRIQIIAVLV 592 Debaryomyces ha...
EEQ38026     453 ESFAVLQNHESHLLSLRLKMVSLLEALIVN-GNMQLVNSKENIKSIVRIIGFEQNFIM---HQPRSKVVHMRLSIISSLL 528 Clavispora lusi...
5X6O_G       613 TIIYRLWkDHFKQLREEQIKQVESQLIMSLWRFLVCQTeTvtanerEMRDHRHLVDSLHDLTIKDQASYYEDAFEDLPEY 692
EMG49723     589 KIVDYLT-QDLREISELMYGELMYEIFVIFSRIAFGSD-S------LSIDAHKLLVKIRAGGLT---PVFNKWCESRARE 657 Candida maltosa...
XP_002549810 577 RIIDYLT-QDLRDASELIYGEQMYEIFVVFSRIAFGAD-S------LSIEAHNLLIKIRSQPKFVDFPVFNKWCENRALE 648 Candida tropica...
XP_001528384 639 KVINYIT-QDLHEASDLIYSETMYEMFVVLLRIAFGAD-S------LSSDAFKLLVKIRSRGLS-KLTVFNEWCEMRARE 709 Lodderomyces el...
CCE43149     589 KIMNYLT-QDLHEASDLIYSETMYEMFVALSRIAFGAD-S------LSLDAHKLLVKIRTQGHF-DITIFNKSCEVRARQ 659 Candida parapsi...
ABN64347     542 KILNYLI-QNAVEYGAFIYPETMYELYVALSRIAFSSD-S------LSDHAHKLLIQVRNKGLK--EPIFNAWCENKARE 611 Scheffersomyces...
CCE87077     592 RLVSYIC-SESRGITGLIYPETLYEIYIVFSRIAFGSN-S------LSVEAHNFLRRIRNNGFY--HPVFNASCEKKARE 661 Millerozyma far...
EDK39210     577 RVLHHIA-TEAKTITNVVYPETMYEVFVILSRIAFGSD-S------LSVDAYQLSSHARQMNYT--GTIYNYWCEQRARQ 646 Meyerozyma guil...
Q6BPF5       593 RILNYIS-SEVRGLNNLIYPETLYEIFVILLRIAFGSN-S------LSAEAHSLLLEIRSKHKY-DKLVFNDDCERKARE 663 Debaryomyces ha...
EEQ38026     529 RVLFYII-DENKNINTLIYPETLHEIFVILMRVAFSSD-S------LSTDAHQFLSEIRGKGLV-DIGVFNKACEWRSRE 599 Clavispora lusi...
5X6O_G       693 IEE------------ELKMQLNKRTGRIMQVKYDEKFQEMARTILESksfdLTTLEEADSLYISM 745
EMG49723     658 LNHivpsn--nhergSEIADIESDFANGLEFPYESETVELARDILNR----FVDHDEAENLYFSM 716 Candida maltosa Xu316
XP_002549810 649 LNHitpq----tsngETIANIESDFANGLEFPYESDTVELARDILNR----FVDHDEADNLYFNM 705 Candida tropicalis MYA-3404
XP_001528384 710 VNHvgllq--kdisgRSLATIESDYANGLEFPYEAETVELARDILNR----FVNHEEADNLYFNM 768 Lodderomyces elongisporus NRRL...
CCE43149     660 LNHltakdfisknggKLVANVESDYANGLEFPYEAETVELSREILNR----FVNHEEADNLYFNM 720 Candida parapsilosis
ABN64347     612 LNHltse----dlqgKFLADIESDFANGLEVAYEADTVEIAREILNT----FVTHDDADNLYFTM 668 Scheffersomyces stipitis CBS 6054
CCE87077     662 INHvtysd--pkvlgNSLADIESDFPNGLEFSYENETVEIAREILDS----CLTREEADNLYFNM 720 Millerozyma farinosa CBS 7064
EDK39210     647 LGHsd--------gvEEMADVESEFANGLEFPYEPEIIELAREILEP----CVTHEEADNLYFNM 699 Meyerozyma guilliermondii ATCC...
Q6BPF5       664 INHitfsn--lhtdgKLVADIESELANGLEFPYETDTIEVAREILDL----CVTHEEADNLYFNM 722 Debaryomyces hansenii
EEQ38026     600 VAHfnifda-rpnkyAELSNIECDFANGVEFPYDSETIEIAREMLSV----CVNHDEADNLYYNM 659 Clavispora lusitaniae ATCC 42720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap