Conserved Protein Domain Family
Oxidored-like

?
pfam09791: Oxidored-like 
Oxidoreductase-like protein, N-terminal
Members of this family are found in the N terminal region of various oxidoreductase like proteins. Their exact function is, as yet, unknown.
Statistics
?
PSSM-Id: 401663
View PSSM: pfam09791
Aligned: 70 rows
Threshold Bit Score: 50.2607
Threshold Setting Gi: 81578692
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7VYW5        14 AVAGDPRPQPPEPPepSDCCQSGCIPCVYDLYDEARERYQEALRAWRA 61  Bordetella pertussis
Q9FFI3        86 KEVGVSVPPPPEKPepGDCCGSGCVRCVWDVYYDELEDYNKQLSGETk 133 thale cress
Q9USH2        48 IYDGIRVPPKPEEP--LNCCQSGCAICVWDVYADDLEEYNRARRKAKR 93  Schizosaccharomyces pombe 972h-
EKD00259      82 eVEGVKIPPKPIPPgdEDCCMSGCVHCVLTIYAEDSEEYQNAMDEAKK 129 Trichosporon asahii var. asahii CBS 8904
EMD34837     135 TFMGFTIPEEPKPPesDECCMSGCAICVYDLYNESLDAYTNALSSIRd 182 Gelatoporia subvermispora B
EKM56609      98 TFMGFTIPGEPKPPepDECCMSGCAFCVQDLYMEALDEYKKAVDSVrf 145 Phanerochaete carnosa HHB-10118-sp
EPS97387     154 TIHGLLLPERPREPqsDECCMSGCAICVYDLYAAALEDYRHALQALRs 201 Fomitopsis pinicola FP-58527 SS1
XP_002469927  88 tFHGLVVPEKPKEPqsDECCMSGCAVCVYDIYEAAREDYMRAVDTLRa 135 Postia placenta Mad-698-R
XP_007331066   3 TFKGFVVPIQPLPPhsDECCMSGCAVCVYDLYEESLEAYNESLDTLRK 50  Agaricus bisporus var. burnettii JB137-S8
ESK84344      84 TFRGVVIPVKPKEPasDECCMSGCAVCVYDLYDESLAAYRESMEKVKA 131 Moniliophthora roreri MCA 2997
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap