Conserved Protein Domain Family
Golgin_A5

?
pfam09787: Golgin_A5 
Golgin subfamily A member 5
Members of this family of proteins are involved in maintaining Golgi structure. They stimulate the formation of Golgi stacks and ribbons, and are involved in intra-Golgi retrograde transport. Two main interactions have been characterized: one with RAB1A that has been activated by GTP-binding and another with isoform CASP of CUTL1.
Statistics
?
PSSM-Id: 401659
View PSSM: pfam09787
Aligned: 12 rows
Threshold Bit Score: 312.442
Threshold Setting Gi: 1133465308
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TBA6       420 NLESSKQELIDYKQKATRILQSKEKLINSLKEGs-gFEGLDSSTA-SSMELEEL-RHEKEMQREEIQKLMGQIHQLRSEL 496 human
XP_785735    423 SAEEAKQELTDYKQKATRILQSKDKLISSLKEG---VEGIEGSTA-VSYELEEI-KNERDMLREELQQANIKIEQLKMDL 497 purple sea urchin
EDO46852     471 NLEAARQEMKDYKEKAGRILQAKDKVISTLREGkqgDESMGA--V-TSAEFDEV-CQERDALKEELNQTRYRMEQVKTDL 546 starlet sea ane...
XP_019853266 454 ELQLLHKEHSEYKVKAAGILQAKEKVIDSLKSSs---EGGGGERG-LEAALDEM-RSEKYQLQSQLINNEQVILSLRTEL 528 Amphimedon quee...
EFX88322     277 ELESTHQSFNEYKLRAQRILQDKDRLLQDIKEHk-tVESFQLPNElLMAELDQL-QQERDLLREETAQSNSQLQQCRMEI 354 common water flea
XP_011434593 451 NAESAKQELVDYKEKAARILQSKERLIASLREGs-gASG-ESVGV-SNLEYDSV-KQERDMFREELQQYKMTIENMRMEL 526 Pacific oyster
XP_002416618 379 SLDLARQELADYKNKAQRILQSKEKLIASLKDAa-sVGGSPL-------DLSDSeGNRSNISAAELEATTQECEQLRAEL 450 black-legged tick
XP_026689699 407 NLSSSKQELADYKQKAARILQSKERVIASLK-Gs-gENDLSSSTI-NSLEAEEA-MQERDQAKDEINSLRIEISDLRSEM 482 vase tunicate
2_pfamImport   1 NLTASKQELIDYKQKAARILQSKERLIASLK-Gs-gETDLSTSTI-NTLELEEA-MQERDHARDEINSLRIELSTLKNEM 76 
XP_003445518 442 AAESAKQELQDYKQKASRILQSKEKLISSLKEGs-gLDALDGSGT-MALELEEL-RHEKDLQREEIQKLQGQVLTLRTEI 518 Nile tilapia
XP_006632616 420 AAEAVRQEMLDYKQKASRILQSKEKLISSLKEGs-gLEGLDGHTA-STMELEEL-RHERDLQREEIQKLLGQIQQLRTEI 496 spotted gar
XP_003756194 419 SVESLKQELTDYKQKASRILQSKEkliSSLKEGs-gFEGLDSHTA-NTMELEDL-RHEKEMQrEEMQKLMGQIQQLRTEL 495 Tasmanian devil
Q8TBA6       497 QDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQK-LRNQLT 575 human
XP_785735    498 QEIESLQQMESESLQEQLRDLEDQEIQSRQSLRETEADLARKCEELRYAEEELHRQRLDLQAKIKDREDDIQR-LRNQLK 576 purple sea urchin
EDO46852     547 QDAEQHQQAEADIAQEKVEGLESALDEERKRREACEQEIRQHMEDLRFSQSELQRSKTSLMNQIQERETEIQR-LKNQIA 625 starlet sea ane...
XP_019853266 529 QEIEDSRSLEVDELRQQVTLSEETLETERQAHLTTQDELSSLQKELDSLKDELVKEKATFVGQMREREKMIED-LKSQVK 607 Amphimedon quee...
EFX88322     355 AHLEARYEEEIRQIRELNNQAETRLLEERSKKELIENELRQLDEELRYVREDLSQQKVQSVGRIQQLETELNK-VRNQLT 433 common water flea
XP_011434593 527 LDMETHLQQESDTSNEQIRSLEENVRSEKQRREDAEQELLKQKQELQYNLEELRKTKMSYQTCIKDREAEIEK-LRNQIM 605 Pacific oyster
XP_002416618 451 QRTQAQA--EALS-----ADFHEQES---ALRR----EVESLQEQQRALLEEVR------QERHQRQDAELESrQAAQIM 510 black-legged tick
XP_026689699 483 QEVEEQHQEDMSSMHQELSEYKKNFQIESSGRREADAEVSRLQEEIRRNEEDLIRSRSSNQARLRDKEVEVER-LRNQLM 561 vase tunicate
2_pfamImport  77 QELEEQHQEDFSSYQQELSEYKKNFQAEFSRRREADVDIARIQEEMRRMEEDQQRSRATNQSRLTDKAAEVER-LRNQLM 155
XP_003445518 519 QDLENQALAEAETWREQQAQLQEQQALQNRAKQEVEAEVERYKQELQYLEEEHHRAKTTLQSRIKDREDEIQK-LRNQLT 597 Nile tilapia
XP_006632616 497 QEVENQQLAESESSREQLQELQEQLTTQRRAKQEVEAELERQKQVCVSAAREQEQSRATRKTKGteigqVLSR-SPLQLT 575 spotted gar
XP_003756194 496 QDMESQQVSEAESSRERLQDLQEQIAEQKAARQEVEAELERQKQEFSYIEEELYRTKNTLQSRIKDREDEIQK-LRNQLT 574 Tasmanian devil
Q8TBA6       576 NK-TLSNS--SQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSASG---SS--S---N---GSSINM 641 human
XP_785735    577 TK-SMSSS--SETELEGRLHALTESLIQKQTMLETLSSEKNSLGLQLERLQRQYKEVQA---TArvT---P---THTVNI 644 purple sea urchin
EDO46852     626 TK-ALTST--SEAELENRVRALTENLIQKQTVIEALSTEKNSLVLQLERLEQQYRDVQA---SA--NrhmN---ATAMHM 694 starlet sea ane...
XP_019853266 608 SSsSQPDS--SRQQLEERLKELTESLIEKQTNLEELTAEYNSTQLQLKRAETAATEAQAkikAA--A---NrpsHTVLNI 680 Amphimedon quee...
EFX88322     434 SK-QNNSStpSQDEFEQRLRTLTETLVAKQAVLEAVQSERSSLLLQLERANKERSGIPS---ET--E---N---STRVLL 501 common water flea
XP_011434593 606 TK-SMSSS--TEGELEARVKTLTESLIQKQTTLETLSTQKNSLALQLERLEQQYKDIQS---SS--L---R----TNTTV 670 Pacific oyster
XP_002416618 511 TK-SMSTT--SEAELEARLHALTESLIQKQTLVEALSTEKNSLTLQLERMERQMKESQM---HGp-K---P---HTAIAG 577 black-legged tick
XP_026689699 562 VR-SQSSP--QESELESRLRQLTEAVIQKQTQVESLSSEKSSLIVQMERMEGQIKRLSQ---EG--G---R---QVSLNM 627 vase tunicate
2_pfamImport 156 LR-SQSSL--QDSELESRVRQLTEAVIQKQTQVESLSSEKSSLLLQLERMDGQIKRLSQ---EG--G---R---QISLHI 221
XP_003445518 598 NK-TLS-S--SQTELENRLHQLTETLIQKQTMLEALGTEKNSLVFQLERLEQQLKNTQG---GQ--S---G---GPAINM 662 Nile tilapia
XP_006632616 576 NK-TLSNS--SQAELENRLHQLTETLIQKQTMLEALGTEKSSLVFQLERMEQQLKSLQG---SA--L---N---GPAISM 641 spotted gar
XP_003756194 575 NK-TLSNS--SQSELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEQQIKSVPG---H---S---N---GPSINM 639 Tasmanian devil
Q8TBA6       642 SG-IDNGEGTRLRNVPVLFNDTEtNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYT 720 human
XP_785735    645 GS-YEEEEASTRQRLPLFMQEAP-SDGGMTRKVKQAASTIDKFSIRLGVFLRRYPIARLFVILYMFLLHLWVMIVLLTYT 722 purple sea urchin
EDO46852     695 GD-ADDSDDNTLSRVKSIASVMPsQIN-DSRRVKRAVNEIDK---------------------CRVLLHVWVLVVLMTYK 751 starlet sea ane...
XP_019853266 681 ES-DSTGSGSSLQPMASMLPESDsLRPRHLRRVRNTLDSVDKIGLRVAWVLRRYPCVRLLTIGYILLLHLWVMIVLFTYQ 759 Amphimedon quee...
EFX88322     502 N--ITDDE---LAKV----------TTGVSRRMRHAYSSLDSLNFRFGQALRRRPAARLVLFFYMVVLHFWVAFVLLTYT 566 common water flea
XP_011434593 671 VN-VHDEEEVRQR-YPGFMRETPtDHE-VTKKMKRAANVIDKFSIRLGVFLRRYPIARVFILMYMVLLHLWVMVVLLTYQ 747 Pacific oyster
XP_002416618 578 FG-QSSEDNTRAR-LPGMFTESPfD-GTMTRKVKRAYGVIDSFSVRAGVFLRRYPLARIFILVYMGLLHFWVMIVLLTYE 654 black-legged tick
XP_026689699 628 EDdVVRNRG-NMSHIPEFGG-GGlD-QGMVGKVRKAASVLDKFSIRLGIFLKRYPPARLFVLIYMGLLHVWVMIVLLTYS 704 vase tunicate
2_pfamImport 222 DDdVIRNRGN-GSHIPQLGSGS--LERGVVGRVKNAASVLDKFSIRLGIFLKRYPPARLFVLIYMGLLHIWVMIVLLTYS 298
XP_003445518 663 SG-LEGA-GARQRNTPVLFSDQDs--PGVYGKVRKAASTIDRFSIRLGIFLRRYPMARVFVILYMAVLHLWVMIVLLTYT 738 Nile tilapia
XP_006632616 642 AA-MEGTEGARLRNVPILFSDTEsPAAGMYGKVRKAASTIDKFSIRLGIFLRRYPVARVFIIIYMALLHLWVMIVLLTYT 720 spotted gar
XP_003756194 640 SG-IDGVEGTRVRNVPVLFNDSEtSMAGMYGRVRKAASTIDQFSIRLGIFLRRYPIARVFVIIYMALLHFWVMIVLLTYT 718 Tasmanian devil
Q8TBA6       721 PEMH-H 725 human
XP_785735    723 PEIH-G 727 purple sea urchin
EDO46852     752 PEIH-T 756 starlet sea anemone
XP_019853266 760 PEIH-Q 764 Amphimedon queenslandica
EFX88322     567 PEMH-E 571 common water flea
XP_011434593 748 PEMH-G 752 Pacific oyster
XP_002416618 655 PEIH-G 659 black-legged tick
XP_026689699 705 PEIHgH 710 vase tunicate
2_pfamImport 299 PEIHgH 304
XP_003445518 739 PEMH-G 743 Nile tilapia
XP_006632616 721 PEMH-H 725 spotted gar
XP_003756194 719 PEMH-H 723 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap