Conserved Protein Domain Family
L31

?
pfam09784: L31 
Mitochondrial ribosomal protein L31
This is a family of mitochondrial ribosomal proteins. L31 is essential for mitochondrial function in yeast.
Statistics
?
PSSM-Id: 401656
View PSSM: pfam09784
Aligned: 59 rows
Threshold Bit Score: 134.986
Threshold Setting Gi: 667789150
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EIM23390       5 SVNLGGLVRKVPWRLSSTRKFRVRERLRDVDQNIQAIKDS------------GVQFKRLDVASA-LPSESAMPPRDKYFT 71  Wallemia mellic...
CCE73325       9 LPLSGGYLWKVAPRLSNPQKLRLRRRMKMVDENIEVLYQSlkkg-----dekLTGHKKIDYLKYdFPKEHEMTPRDKYTT 83  Millerozyma far...
Q6BXB7         9 LSLSGGYLWKVAPRMSGPQKYRLRRRMKTVDENIEVLYKSlkld-----nveSTGYDKIDYLKFqFPKEHEMTPKDKYTT 83  Debaryomyces ha...
XP_006690012   9 lTNHGGYLWKSAPRLSSPQKSRLRQRMKTVDANIEAIYQSlpkd-----hngLTSYRKVDYLKFkFPKENEMSAKDKYTT 83  Yamadazyma tenu...
EEQ38976       9 LARCGGYLWKKAPRLSPPQKQRLRNRMKLVDRNIEILYQSlkpa-----nakSTGFKKIDYLKFeLPKEAQMSPRDKYTT 83  Clavispora lusi...
Q5ALU1         5 lVRSGGYVWKFTSRLTTTQKYKLRSRMKQVDENIKNIYQGliamen-ksmgePTGLKKIDYLQFeFPKENEMTTRDKYTT 83  Candida albicans
CCE43387       5 lVRSGGYIWKFTPHVTSTQRVNLRKRSEQVDANIDQIYRGliqqtgdkkmgdKTGYPKIDHLKFdMPRFNQMSSRDKYTT 84  Candida parapsi...
EER34407       5 lVRYGGYVWKYNKRISTAQKTKLRSRMKQVDENIENIYKGllqiqg-ksngeLTGIEKVDYLKFqFPKENEMIARDKYTT 83  Candida tropica...
XP_001383442   9 pVVSGGYLWKVAPRLSGPQKYRLRNRMKQVDQNIENIYTAlvaheg-kkqgeSTGYAKIDHLKFsMPKESEMAPRDKYTT 87  Scheffersomyces...
XP_007374759   9 lVRCGGYLWKKAPRLSPPQKYRLRKRMSLVDENADAIYRGliqaqg-kaigePSGFRKVDYLKFeMPKENEMLPKDKYTA 87  Spathaspora pas...
EIM23390      72 FNKNSPTYRKGVHKVPKWTKITQRTNPAGF 101 Wallemia mellicola CBS 633.66
CCE73325      84 FDKKVKGYRKWVHLVPRWTKKSFRENPKYF 113 Millerozyma farinosa CBS 7064
Q6BXB7        84 FDKKAKDYRKSIHRVPKWTKLSFRENPKYF 113 Debaryomyces hansenii
XP_006690012  84 FDKKAKDYRKLVFKVPKWTKKSFRENPMHh 113 Yamadazyma tenuis ATCC 10573
EEQ38976      84 FDKKSKGYRKSVHLIPKWTKKSFRENPKYF 113 Clavispora lusitaniae ATCC 42720
Q5ALU1        84 FNRHSKNYRKPVHRVPKWTKLSFRENPKYF 113 Candida albicans
CCE43387      85 FSKHSRDYRKPIHRVPKWTKLSFRENPKYF 114 Candida parapsilosis
EER34407      84 FNKNWKDYRKPVHRVPKWTKLSFRENPKYF 113 Candida tropicalis MYA-3404
XP_001383442  88 FTKHSKTYRKDLHLVPKWTKKSFRENPKYY 117 Scheffersomyces stipitis CBS 6054
XP_007374759  88 FNKHAKNYRKKLHLFPKWTKTSFRENPEHF 117 Spathaspora passalidarum NRRL Y-27907
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap