Conserved Protein Domain Family
Guanylate_cyc_2

?
pfam09778: Guanylate_cyc_2 
Guanylylate cyclase
Members of this family of proteins catalyze the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate.
Statistics
?
PSSM-Id: 401652
View PSSM: pfam09778
Aligned: 30 rows
Threshold Bit Score: 234.846
Threshold Setting Gi: 217408412
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002416105  13 RHVEQKLSWDCGVSCVAMLLATDRERRDFLANRDRISQEEGFGASTWTIDLCYLLRRYGI-DHVYTTVTLGVNPKYKNEL 91  black-legged tick
ESN98538      34 HHVRQHSNWDCGLACVQMILKTYDKN---IDNFKSVCVRLNLKTSIWTIDLAYILQYYHI-AHKFMTITLGVDEAYSKKS 109 Helobdella robusta
EPB91549      29 PHILQDTNWDCGLACVVMTLRGLGFNVS-LEDVARQCP----VNSVWTIDLAFLLRNYVH-DFTYYTSYLGSRKEYQDQK 102 Mucor circinell...
EGF78764       1 -------SWDCGLACTSMVLAGLGIPRSTLLDVSNMCS----TRSIWTVDLVYIFRHYGVqDFTMYTSYIGVNWQNASKP 69  Batrachochytriu...
EFJ14805       2 PHVRQLRSWDCGLACVSMVLRALGIESCNLKTLSQLCR----NTSIWTVDLAYLLRHFSV-DVAFLTITLGANPLLAVES 76  Selaginella moe...
ERN12004      77 PHIQQLSTWDCGLACVLMVLKTLGIDCGDIPCLEKLCC----TTSVWTVDLAHLLHKFSV-KFFFLTVTLGANPNYAVES 151 Amborella trich...
XP_002277052  58 PHMNQLSTWDCGLACVLMVLRTFGINNCNIQALEELCC----TTSIWTVDLAYLLQKFSV-SFSYFTVTLGANPNFSVET 132 wine grape
KRH31061      56 PHINQIYTWDCGLACVLMVLKTIGVNNCDIQTLAELCC----TTSIWTVDLAYLLQRFAV-AFSYFTVTFGANPNYSIES 130 soybean
Q8L870        60 PHVHQLASWDCGLACVLMVLRASGIASCTLEDLAEICS----TNSIWTVDLAYLLQKFCV-EFSYYTITFGANPNYSIEE 134 thale cress
EEF38183      25 PHVSQLHSWDCGLACVLMALNTIGINNCSIQALAELCS----TTSIWTVDLAYLLQKFSV-RFSYFTVTLGANPNYSAET 99  castor bean
XP_002416105  92 YYKLSLLRDHQRVEDRFREASSRGVIVERRSVTLLDILEHLSRGS-PIIVLVDQGLLY----------CDACQASnRIVA 160 black-legged tick
ESN98538     110 FYKDNYDEDSARVEAMFNNAGEAGVNITECSVGMDEIVKHLKSNR-PIIVLIDWNIVKwtsslplkcqC----------- 177 Helobdella robusta
EPB91549     103 FYQEDFDEDEKRVNKLFAIAKSCSVHVVRMMLPLDDFKRFLYCKKfAIITLVNARLLK----------CQLCRRHrGCLG 172 Mucor circinell...
EGF78764      70 FYRDSIAEDLKRVHSLFAKARACQVRIVPLVLAMDDICRFLASNRyAIIILVNFNLLK----------CTTCSKNkAKTS 139 Batrachochytriu...
EFJ14805      77 FYKDNMEADEKRVNKLFEKAPQAGIQIQWRSISGEELAMLILSGRyLAIALVDKHKLRyfl----fsnSEYLL------- 145 Selaginella moe...
ERN12004     152 FYQDNLPDDIRRVNGQFQVALENGINIQCRSIGGEEISVLILSGKfVAVALVDKHKLScrp-----wlEEICLP------ 220 Amborella trich...
XP_002277052 133 FYKDQLATDLVRVDSLFKKAMEAGIDIQCRSISGDEISLLILSGKyIAIALIDQYKLsqs------wlENVHVS------ 200 wine grape
KRH31061     131 FYKEELPNDLVRVDLLFQKAVEAGIDIQCRSISEEEISILILSGKyIAIVLVDHNKLRfcfs--hvlqEDVPMP------ 202 soybean
Q8L870       135 FYKEQLPEDLVRVDLLFRKAHESGIIIQCRSVSIHEISCLLLSGNyIAIALVDQDKLsks------wlEEVLVS------ 202 thale cress
EEF38183     100 FYKEQLPTDLVRVDRLFQKAREKGINIQCRSINEKEISLFILSGKyIAVALVDQYKLsrs------wvEDVILS------ 167 castor bean
XP_002416105 161 K------VSGMLGKCFPFQGHYVVLCGYRMSEKKLLYRNPSKSERLCSVPFDAFEKARKRFGTDEDVIFV 224 black-legged tick
ESN98538     178 F-------GNVMKKVTSYQGHYILLNGYNEKKKSIYYHNPEKSDVVHNIRLDVLEKARKAHGTDEDIIFI 240 Helobdella robusta
EPB91549     173 SvcgqldLLLEKFKGNDYLGHFIVLIGYDPTEDLFIYRDPAANDEFCTISADDLDDARQSEGTDHDCIVV 242 Mucor circinelloides f. c...
EGF78764     140 ---------TIYDQQNEFEGHYIVLIGYDAARDVVYYRDPGVSDTLCSVKVDCLDKARMSCGTDCDLIVV 200 Batrachochytrium dendroba...
EFJ14805     146 ---------RASPGDVDFAGHYVVICGYDLETNEFEIKDPSSSSCSDKLPLEALDEARKSFGTDEDILLV 206 Selaginella moellendorffii
ERN12004     221 ---------EIYGGTSGYTGHFVVICGYDADTNEFEIRDPASSRKYERVSLECLEEARKSFGTDEDILLs 281 Amborella trichopoda
XP_002277052 201 ---------GFCGGYSEYTGHYVVICGYDVDTDEFEIRDPASSRKHERISSNCLEEARKSFGTDEDLLLI 261 wine grape
KRH31061     203 ---------GLFSNNPGYTGHYVLICGYDAGADMFEIRDPASSKKHKRISSKSLEEARNTFGTDEDLLLI 263 soybean
Q8L870       203 ---------GLHSSNSCYTGHYVVICGYDAVRDEFEIRDPASSKIHERISSKCLENARKSFGTDEDLLLI 263 thale cress
EEF38183     168 ---------GLKDSKSSYTGHYVVICGYDANADEFEIRDPASSRISERISSKCLEEARKSFGTDEDLLLI 228 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap