5OOL


Conserved Protein Domain Family
Mitoc_L55

?
pfam09776: Mitoc_L55 
Mitochondrial ribosomal protein L55
Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.
Statistics
?
PSSM-Id: 401650
View PSSM: pfam09776
Aligned: 17 rows
Threshold Bit Score: 142.173
Threshold Setting Gi: 74803560
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OOL_MM       11 LRQSTVKATGPAl-RRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEER 89 
XP_005628411  11 LRQQVLTGTAPV--CRLHTSSWQADSNRALLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRILEMPVDLDALSPEER 88  dog
XP_010599033  19 LRQSLTKRAAPSs-CHLHTSHGWADCQRASLTRLYRQAYARLYPVLLVKQDGATIHIRYREPRRLLAMPIDLDCLSPEER 97  African savanna...
XP_003762271  11 lqqnlAKIGFPTl-HHLHTSSIQLNSNRASLTRMHRKMYARLYPVMLVKQDGSTIRIRYREPRRILTMPVDIDTLSPEER 89  Tasmanian devil
XP_005991188  17 lrhSGIGRMLPAa-CCLHSTPARHNSNRTSVVRCGRQTHARMYPVLLVRPDGSTIKIQYKEPKRILMMPVDISTLTEEER 95  coelacanth
Q9TYJ8         6 NTQISMRNLLTS--CSKAITAERNNAWRASLGKISRRDYLHRYQVKFIRPDGSTIMVPAAEPRQTFQSAVDLKQLSEDER 83  Caenorhabditis ...
EEC12505      12 PSVHGCRSAL--------GTQCRNNSNTASISRIKRATYVRLYPTVLVQPDGSTINVRYHEPRQLIRLPLKFEELTPEQQ 83  black-legged tick
Q9CZ83        10 LRHCGVRAALPTp-RHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEER 88  house mouse
XP_014586330  11 LWQCAVTGATPTg-RHLHTSSWRADSSRASLTRVRRQTYARLYPVLLVKQDGSTIHIRYREPRRMLGMPVDLDALSPEER 89  horse
P0C2B8        11 LWQCGMTRAAPEscRYLYTSSWRADCNRASLTRVHRQTYARLYPILLVKQDGSTIHIRYPEPRRILTMPVDLDSLSPEER 90  cattle
5OOL_MM       90 RARLRKREAQLQSRkEYEQELSDDLHVERYRQFWTR 125
XP_005628411  89 RARFRKRESQVQKK-KEEPELYDDFDVERYKQFWTK 123 dog
XP_010599033  98 RARFWKREAKFREK-KEELDLQDDFDVERYKQFWTK 132 African savanna elephant
XP_003762271  90 KMRLRKRSSKYIEVdKKEAEFGDDFNVEQYAKFWKK 125 Tasmanian devil
XP_005991188  96 KARLRKRDLKKTSArEEKDEFEDDFDMDKYSKFWKK 131 coelacanth
Q9TYJ8        84 RQRLAAR--KPKAKiTKTEVIDDTFDESEYMKFWSa 117 Caenorhabditis elegans
EEC12505      84 QIVLVKR--KPPEKlVVQEEIEDNFDGNKYLKFMKK 117 black-legged tick
Q9CZ83        89 RARFRKREAQLQQKrEEEPEVVDSFDTERYKQFWTK 124 house mouse
XP_014586330  90 RARFRKREAQLREK-EQQPELADDFDVERYKRFWTK 124 horse
P0C2B8        91 RARFRKREGQLKEK-KEEPELADDFDVEQYKQFWTK 125 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap