Conserved Protein Domain Family
Keratin_assoc

?
pfam09775: Keratin_assoc 
Keratinocyte-associated protein 2
Members of this family comprise various keratinocyte-associated proteins. Their exact function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401649
View PSSM: pfam09775
Aligned: 21 rows
Threshold Bit Score: 96.61
Threshold Setting Gi: 328872645
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFA10994              3 VTTGISFVLASISSVLVFSGMQMYKPWLSSSQVHTLLGGYLGSIFFVLSLTAVGNL-ETCVFGRSFQVKVFPEVLFCLFL 81  red flou...
NP_001155495          3 VSTGMSFLISTLLALSLFSVMQLNSKWLTSSSVLVIGTGFLGSVLFTLSLTAVSNL-MTLLLGEGYQASLFPEIILSLLF 81  pea aphid
Q8INQ7                8 kSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFSWVFILSLTCVSNA-EMVVFGQDFQAKLLPEIIFCLSL 86  fruit fly
WGS:AAQB:GK11592-PA   8 kNTLVSSIISGILSLLIFAILRFCSDWFNGSQINVLVGGYLFSWLFILSLTCVSNA-EMVIFGKDFQAKLVPEIIFCLTL 86  Drosophi...
XP_006007331          3 VGTGTSLVLSSLLSLLLFAGMQMYSKQLASTEWFTILGGFLGSVLFVFLLTAFNNL-ENLVFGKGFQAKIFPEVLLCLLL 81  coelacanth
XP_003137992          2 aNHSTSALVAFLIAIIIIAIGQIMKNDLAASKAGTLIAGALGSLVFVFLLTALSNF-QMSSISEQVKAGLT-EVFLCLVV 79  eye worm
CCD78943              3 LKSGASSFMSLLLLLVVFAAMRLFAETLSSSQILTIFGGFFGSLIFVLLITFVNNF-ERTLFGDEFCSGVFPEVAICIVI 81  Schistos...
EGG21012              7 pSTGNTLAFSALSFIIVLGALQLNASFFQSTNNRTVVGGLVGSSLFFFLLTFLGAVkKELKW---------VEVLLSLFI 77  Cavender...
Q0DH81                3 STGGRSMALSLLLFAVTLSLLEMYRGRFASSELMTIAGGFVSSLLFLFLLTFIGNYqEANGVKTGWGAVVVAEL-----T 77  Japanese...
Q9FVX3                3 GAVGTSMLGSLIVFTVILSLQEIYRGKLASSELFTILGGFTSSLLFLFSLTFIGNFqESSGIKSGWGAVILAEI-----I 77  thale cress
EFA10994             82 ALFTSATVHRVSATSCLLISLCALFYMNKHSQKVHAMPAPSIPVQTGKKK 131 red flour beetle
NP_001155495         82 TFFTCVSIHRVCATTGLLFSLFALYNIYNVSQKTYN-SSSLLKQPIVQNK 130 pea aphid
Q8INQ7               87 TVAAAGLVHRVCATTSVLFSLVGLYFLNRISTKYYSVQVPSVdapttrkg 136 fruit fly
WGS:AAQB:GK11592-PA  87 TVAAAGLVHRVCATTSFFFSLLGLYFINRISSKYYSNAAAAVDVPVKKSg 136 Drosophila willistoni
XP_006007331         82 SLFASGLVHRVCVTTCFIFSAFGLYYINKISAALYQSSVPIITPAKPSGK 131 coelacanth
XP_003137992         80 AVIASATIHRVAITVCLLFSAFLLFLLTGISQTRYTTTVVQNVVQQRKKK 129 eye worm
CCD78943             82 ACSFSATIHRVCGTTCFIFSLVMLYYLIRISHEVYQ-SNEQVTTSSSSRK 130 Schistosoma mansoni
EGG21012             78 TFTISSSVHRVSGTTSVLFSFAILYYVNTMSKKLLK-EDSTPVATTTKSK 126 Cavenderia fasciculata
Q0DH81               78 ALIVAGTVHRVCITTCFLFSAGFLYEVDKLSGMILA------KSESKA-R 120 Japanese rice
Q9FVX3               78 ALIAAGTVHRVCITTCFLFSAGLLYEVNKISGYMLS------KTESKSKR 121 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap