Conserved Protein Domain Family
Meckelin

?
pfam09773: Meckelin 
Meckelin (Transmembrane protein 67)
Members of this family are thought to be related to the ciliary basal body. Defects result in Meckel syndrome type 3, an autosomal recessive disorder characterized by a combination of renal cysts and variably associated features including developmental anomalies of the central nervous system (typically encephalocele), hepatic ductal dysplasia and cysts, and polydactyly. Joubert syndrome type 6 is also a manifestation of certain mutations; it is an autosomal recessive congenital malformation of the cerebellar vermis and brainstem with abnormalities of axonal decussation (crossing in the brain) affecting the corticospinal tract and superior cerebellar peduncles. Individuals with Joubert syndrome have motor and behavioral abnormalities, including an inability to walk due to severe clumsiness and 'mirror' movements, and cognitive and behavioural disturbances.
Statistics
?
PSSM-Id: 401647
View PSSM: pfam09773
Aligned: 30 rows
Threshold Bit Score: 697.127
Threshold Setting Gi: 968101743
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015791560         198 SQCIPCHASMKN-------CS--CPKDHy--TLYGGLCLp--NGNLITEKVDLYKV-------TYENGEQV---NSAFFM 254  two-sp...
XP_002054171         158 SDCHSCNAAY-----------------N---YRYQDYCI----AHTLLHPYLHYNA-------FWQATIKSk-pSSQLSR 205  Drosop...
WGS:AAQB:GK22712-PA  161 SDCHSCDLIY-----------------N---YQYQGYCL----ANVLLRPYLHYNS-------FWQSTTNSkpsLNNNIA 209  Drosop...
A0DDG3               114 EQCVPCPDKLMIyt-------gsCECPQtgyIKSYDRCIl-sTQKTIGSLIFDSSY-------IVEYETDQkiaSSYMLS 178  Parame...
A0BV64                90 nlCQQCPNNQVNvs---gkCS--CSASS---LASDNYCVg-lYINVFSDDISQVLG------------------------ 136  Parame...
XP_001317146          35 fdCVDCG----TednytypCVpeCESPN---ELIGTICVnstEFAELKANVTTNTSknfrfynLVNQTENKafqTSYNNN 107  Tricho...
CBZ12062             174 GAC-RCSAGFTMlyd------gsCVPTE----AYESMAAa----aSGTSTALSPPN-------IDNSGAAGpltRVFPAQ 231  Leishm...
Q4DL05               215 GEC-VCASGYTTlyd------asCVPTE----VYNGVVVa----aVGATTTFQPLN-------LNNKGILGpsvTSVVVR 272  Trypan...
Q57UB2               176 GRC-VCAGVYVQldd------gsCVLPS--------VQVearKPVEATTATLLPVD-------TEGGGIWGpplTCENIE 233  Trypan...
NP_001097846         173 GDCHSCDMTH-----------------N---FRYQDFCL----ASTLLRPYVHYNA-------FWQATTT----PDSSAP 217  fruit fly
XP_015791560         255 EN---LQSSIYQCQYQGNRSACQLLANLCTFlnyNLYetssfggfiginsvksKANACTEFLKLS--KLPS--------- 320  two-sp...
XP_002054171         206 LHfgdLKFVAFFCLALKNDSACQQLANLCVLshySMD----------------KHSPCSPFLLT---QMSDvvmkyahag 266  Drosop...
WGS:AAQB:GK22712-PA  210 HNfgeLKFVAFFCLALRNTTACQQLANLCVLshfSPD----------------KHSPCSPFILT---QMSDvvmkyahsg 270  Drosop...
A0DDG3               179 RY----QYAITMCYYYSSINACQLLANLCVLqlfDLT-----------------KPICSIFLDELssKIPAs-------- 229  Parame...
A0BV64               137 ------PKAYDGCNLYNDMVSCQQLANLFILkrsTVSt---------------EKDFTYLYNAVLtfQNKKn-------- 187  Parame...
XP_001317146         108 TYnklVESITVLNYQSKAPQQREFLANVCAAnhfSLK-----------------SQACTLATSFAdiMTAKqydyn---- 166  Tricho...
CBZ12062             232 TY---SLGAALLCSRG-NSTACNLLANLCVVmdyQVT-----------------AMPCALYQHIKqsKPCDdpwce---- 286  Leishm...
Q4DL05               273 SY---AMDSAVQCMRG-MAVGCSLLFNMCVLmmyDVD-----------------SLPCKLYLSVRdkRTSYr-------- 323  Trypan...
Q57UB2               234 EY---SADAAVRCEGL-DKSACNMLANLCVFmnfDEA-----------------STPCRLYDTLFsqSPTKp-------- 284  Trypan...
NP_001097846         218 SRfgeLKFVAFFCLTLRNDTACQQLANLCVLshfSLE----------------KHSPCSAFLLT---QVSDvvmkyahsg 278  fruit fly
XP_015791560         321 ------VPFLIYG-DNG--VNE---LKKANVISKMFKI-----DSR--LELIAARYNVHGTLVDYSPLKLGELQLCQSEP 381  two-sp...
XP_002054171         267 eqlralEPFLFYK-KGRttREF---LTTTLQLAn---------QKE--LQILSTTYDLAGRLKRWGGFKLEQLNLCQGQR 331  Drosop...
WGS:AAQB:GK22712-PA  271 eqlrslQPFLFYK-KGKatRDL---LSKTLQRSn---------VHE--LQLFSTTYNLAGSLKRWGTFSLEHVNLCQ-QP 334  Drosop...
A0DDG3               230 ------APALFPS---VntETI---NIYQTAFPQTMKLddsdsKGRryLNYAIQKYDLDGNLISDSTLR-SEFILCPHSP 296  Parame...
A0BV64               188 ------MPSIIHEvSTTvtSVT---LIEDTPIQMQVNFkedraTSLnrMPFYVMEYYIDGSVSELKPLQ-NQFQLCSSSY 257  Parame...
XP_001317146         167 -fwpknDLFLTYI---NrdDNE---IFKENIILSKFSAgr-------iINITFARYSFDGEFLGFKVLE-LDTERCRHKQ 231  Tricho...
CBZ12062             287 --tidgLPWLYYTrSNAdvLSN---VTTEYRLSARQK-----------LQLVVSVFDLYGNWLGYQSVV-SQVNPCFLKN 349  Leishm...
Q4DL05               324 -----rLPPLFDGdNTDtyTSDdgvLLATTNITAAGDP----------MTFLVAVYDWRGNLKGLRHVS-EVLNLCCISD 387  Trypan...
Q57UB2               285 -----yMPPLYYG-RDDtvGSV---VLNSSSLTGAPAT----------LTFVVARYDLNGILVGKSLLS-RDFKLCNTPG 344  Trypan...
NP_001097846         279 eqvrslQPFLFYK-KGRatKEL---LSKTLQLPd---------RKE--LRLFSTTFGLDGGLKRWGAFHPEMLNMCQ-QK 342  fruit fly
XP_015791560         382 DSLDSGFYFGTNYYQ---KCEIDLRTLWDTkaSSiSSIlLYDLYLL-DDDQEPNTVYPIPVIVTNLMENG------EAVN 451  two-sp...
XP_002054171         332 A---PTLQFAQHQPEi--SCQLSLEQLIDVasLEaNDN-YYNLYLNf-SSNWVHLLHQLPVLVETL----------TPEN 394  Drosop...
WGS:AAQB:GK22712-PA  335 A---PNLHFGQKQTDv--SCHLTLEELIDLagQQgNDN-FLSVYLNf-TSNWQFLLHQLPVLIENL----------TPEN 397  Drosop...
A0DDG3               297 GDEINSRAFGLNMKI---SCTLDLDAFLQN-----YEMyMYELSVTaIRDDNTIVPQNVYFLVNNLKDKDg-----NLPN 363  Parame...
A0BV64               258 GDTDLASNFGVSYKN---DCNVDFTKYLNSn----YQTvFYSVWIKd--IDGSFIQVPIKIADYDGNGNGetedqyGYTN 328  Parame...
XP_001317146         232 ETENIWRKFGSNYYS---SCAINIYEEMNFtsNE-----FYDPFIQdNMVGSYPVLRPIPVLDMSFADESg-----NLTN 298  Tricho...
CBZ12062             350 TELQTFFAAGDTRAT---SCHVNWHWFLRA-----NRTlFYEVYLRh--PFNASRLMPVPLLI-------------DYSN 406  Leishm...
Q4DL05               388 ADMSSFFKVGSNRRL---RCFFDWYKLLQDa----GPTyFFELFMRd--FTNTSRLVPVPVVM-------------DYTT 445  Trypan...
Q57UB2               345 SIFTNFFVVASNREL---RCSVKWEELESDy----STTqFFELFLVn--PFNVSDDIPIPLVV-------------DDTD 402  Trypan...
NP_001097846         343 A---PSLRVALPKREsevSCQLTLERLIDLanQRhNAE-FLTVFLNf-SSNWQYLLHQLPVLIETL----------TPEN 407  fruit fly
XP_015791560         452 K---GDDEQKRRLVR-----------------RFYLAEALIGIElk-kDGISDT-PlessksseafkgssklsegssDYM 509  two-sp...
XP_002054171         395 Q---HPHEEEWQLVK-----------------RFQLISGQPRDN----RQQPSL-Pryedah----------klqlyRSL 439  Drosop...
WGS:AAQB:GK22712-PA  398 Q---REQRDEWQLVK-----------------RFQMISTVSTNS----HQQQSV-Lnryeda---------hklqlyRSI 443  Drosop...
A0DDG3               364 T---DKATQNSIFVK-----------------RIFLVDTLTSKKdytsPAET---P---------------------EYI 399  Parame...
A0BV64               329 T----------KFLW-----------------RFFMVDNLKS-------------P---------------------SEI 347  Parame...
XP_001317146         299 Li--NNGTSNLYYAR-----------------RFFLMDNSTTD----------------------------------DII 325  Tricho...
CBZ12062             407 YgfePATFHDPWLYRgravasngamseggfrrRFYAYDNVGGSS----DALLRSlP---------------------SYV 461  Leishm...
Q4DL05               446 GnihPQSLRDGTLRRamat---------gyrrRFYLYDTLTDCKldvpQVTETT-P---------------------CYV 494  Trypan...
Q57UB2               403 GgisPSNAREVHVLSmitg---------gykrRFYMYGRGCTRKgnstEQVLTD-----------------------YHV 450  Trypan...
NP_001097846         408 Q---RPQQEEWQLVK-----------------RFQLISASPRDS----HLHQTM-Pryedah----------klqqyYSL 452  fruit fly
XP_015791560         510 RYAQSITINIAISKTDGSGSIYTPWIKITYGTVTKED------------------YIn---GIKVPIEFCINYSADQSK- 567  two-sp...
XP_002054171         440 RYVDQVELQYSIQD---GHRIGLPLLRLRYRHIELAG------------------NAs--lTQLYPFRLRVHFEQVRQGv 496  Drosop...
WGS:AAQB:GK22712-PA  444 RYIEHLELHYTVEE---DQRVGLPLIRVRYRLIELAG------------------GNvs-lSQSFPFQLKLSYERLQRSw 501  Drosop...
A0DDG3               400 RYASKIQI-VILPSQDSYEQIYVPYVYVEYSIVRNSGe----------------------sFGYADFEFALQISPDPTN- 455  Parame...
A0BV64               348 IYAKSIRL-ISYLSTKEDDKTFLPYFYVIYSEPISITti--------------------enEKYYPVKYGHYYYQAKTS- 405  Parame...
XP_001317146         326 QYLVNFTL-IFTTSSTKADNITTPKIIVRYKQFPRSIleas----------tpsyEKlketTSQPAYEFNVVYSKDMKS- 393  Tricho...
CBZ12062             462 TALRSASL-VLGADHRDDRYVATPLLVLQYASKMVSTiadaaptddleeerqtplNTsgqpDYTLHCQMRSYYLSSTDS- 539  Leishm...
Q4DL05               495 TALRHVVFALEVVDVYRDHHSLKPVVYLQYASGLKKAhn--------------gdLTartaNNIVEGGVSVLFIASSS-- 558  Trypan...
Q57UB2               451 TTVRRVVFVFNVEGPSIQRRLKAPAAILQLASTKLYDda--------------psFSapsnDTYLTRSVAVLFTLVDDP- 515  Trypan...
NP_001097846         453 RYVEDIEIRYTLDK-DQPDRVGLPLIRLRYRHIEMGS------------------GNis-lSQLYPFTLRISYDQVKRGw 512  fruit fly
XP_015791560         568 -NARDLSICQGVFCGFAVLIALFRAWAWTKRQGK-QAVD---PVTISEFLLISISFLADAFFLVCLGFSIHSFIIYKQQS 642  two-sp...
XP_002054171         497 aAKLLMELALPLLLLVALVAALLRLQNLRRRRRT-ELCQ---TTNLLELMLQLAGNVALALLATA-------LLLLTLQA 565  Drosop...
WGS:AAQB:GK22712-PA  502 -DWLILEIALPLLLLVAFAAAVFRFQNIRRRRQS-ECCQ---ISNILEFLLELATNVAWALLATV-------LLMLLLQA 569  Drosop...
A0DDG3               456 -YWVTIIILFAIYNVIIILVWLFRIYVWTKANPSsSIREnymLQLIKNMAQLLIDSWTDWMFYFLFFMTAYWFIFFKFQN 534  Parame...
A0BV64               406 -FYTVASALLIVAHIFIIIVWFIRIYVWTKRNPSyTGQNdwcMYLTIRSFYVLLDTWAEVIFYYLAIFTGYLFCFFKFQQ 484  Parame...
XP_001317146         394 -FWDVAAIVFSMIFILGLFVFAYTAFVSIKKHGN-GGFG---LYLILTLLGNLLDQIGNIFVVMVYGYSIYYFFFFKLQS 468  Tricho...
CBZ12062             540 -VSQGLKVAVIVLCALCFFSAWVRTYGWMRRRQY-LVLD---SFAVLRFFVYLCNHISNMFFLAVAVASWYMFIAYKGQS 614  Leishm...
Q4DL05               559 -VDKGMMITMIIFCLLCICSAWIRTYGWMRRRQN-VMLS---IGAVIRFMVYFCNHIGNLFALVVSLASWYIFVLYRAQK 633  Trypan...
Q57UB2               516 -MDVVAMRAMVTACVLCFCTAWMRTFGWMRRRQN-MILN---GGAAIRFLVYFCDHSGNMFALITLLASWYLFFVYKFQD 590  Trypan...
NP_001097846         513 -DWLILEVALPLLLLLAFAAAVFRLQNLRRRRKA-DLCQ---MSSLMEFLLQLAGNVAYALLATT-------LLLLLLQA 580  fruit fly
XP_015791560         643 -VIHGLLP--ST--SFESTIRIYLYIAFALKCVKILHDLIILSHTNIFLIDWERPRvitvtkrsrpeeterktvnddgil 717  two-sp...
XP_002054171         566 --------------WVPEQLALLIYPACLLQLIFLAVHLRRASQLELFLIDWERPR------------------------ 607  Drosop...
WGS:AAQB:GK22712-PA  570 --------------TSLRTLKLLIYIAFWLQFLYLSVHLWRCSQLELFLIDWERPR------------------------ 611  Drosop...
A0DDG3               535 tPFLLMLN--QNepSNYLPFYGLFYTIFALRLIQTLAIIYAQSSISIYFIDWETTEi----------------------- 589  Parame...
A0BV64               485 -TIYILMPdlSDyaNNYRPFEILFYMMFACRLISMFNLILRQADVQVFFIDWEKSE------------------------ 539  Parame...
XP_001317146         469 -DLAVYLP--YG--EEFRFLIAFISTAFVFKALASIIKLLLVTGHQFFIIDWSQED------------------------ 519  Tricho...
CBZ12062             615 -SLSRAMR------LGDAYVNAMLYVAVTGKGVTVLYRLAEQCNADYFVIDWERSK------------------------ 663  Leishm...
Q4DL05               634 pNLSMFLS------DNYVFLEAMLYAATAAKGIAVVYKIVEQCNADYFVIDWERSK------------------------ 683  Trypan...
Q57UB2               591 vSAVVVIK------DKYVCFEAMMYVSAAAKGIAVLFAVIEQCNADYFVIDWERSK------------------------ 640  Trypan...
NP_001097846         581 --------------SNSRLLKILLNTAFVLQFLFLGIHLWRSSQLELFLIDWERPRs----------------------- 623  fruit fly
XP_015791560         718 sankkaSASISsaGAGTRKSsASgnassigltekisqdklhfahcPAVSIWRTYFVANEWIKLCTYRRIKTSLHLFLVLL 797  two-sp...
XP_002054171         608 ---------SS--CEGQRLNlDStslcssv---------rtyvaeSSVSAWRVLFTANAWIRLSATQRYSSLVQAFVVIV 667  Drosop...
WGS:AAQB:GK22712-PA  612 ---------SS--CEGQRLNlDSsslcssv---------rtfvaeSSVSAWRVLFTANAWIRLSVAQKYSSLVQIVVVIA 671  Drosop...
A0DDG3               590 ------HRPVEkrRQEELEEnEIlvta--------------nkikSKVSVWRTLLVANEFNELSTVRTVSVEWTLIILGF 649  Parame...
A0BV64               540 --------VLRprELAEKLDnNVlrmv--------------eqaqSKQSAWRMILIANEFNELQIYRIVSVEWTLLFVGF 597  Parame...
XP_001317146         520 ------------------KNvDE------------------------SKVWHRLLVANEFFKISTVRYYNMPFTIMIVVL 557  Tricho...
CBZ12062             664 ---------------GQLLReNKv---------------------VPVSMWRSTFVANALNELQALRYWCPLLTMTIVLL 707  Leishm...
Q4DL05               684 ---------------GQLLReNRi---------------------LPVSMWRSTFVANELNELQVLRQWRPLLSMTIVLF 727  Trypan...
Q57UB2               641 ---------------GQLLReNRv---------------------LPVSMWRSTFVANELNGLQVLRQWHPLFTMVMMLF 684  Trypan...
NP_001097846         624 ------------sCEGQRLNlDSsslcssv---------rtfvaeSSVSAWRVLFTANAWIRLSVTQKYSTLGQVFVVIA 682  fruit fly
XP_015791560         798 FLIGFGLENLATSDTQNNLKrdSGQ-RFVPESQTCRLAIGSLVFFLLGLAQLGWHRMFQERMY-KNKLDEFVDLCSVSNV 875  two-sp...
XP_002054171         668 VDQL--LQRFTQTQSDFG----------------LSCCLISAVYLATYLLQLVLCRLLY-----SNPLQKFVDLCSLANI 724  Drosop...
WGS:AAQB:GK22712-PA  672 AYQL--WDRYTHKE------------------LALRCCLISVSYLIAYLLQLLTQRMFV-----GNPLQKFIDLCSLANI 726  Drosop...
A0DDG3               650 VLIGLGFQKRFIESPDLI-----ETqPFVPENPILKYFLVQFVYLMIGLGQLILRRILNIWQ--PYPYENFVDLCTIANV 722  Parame...
A0BV64               598 FLEGLNWINLGQEQPNLS------LdKTIPKNYVLQYFLCTFLYMAIGLAQIIIQKLFDIWF--PILVEDFVDLCAISNV 669  Parame...
XP_001317146         558 LQVAIKLELFASPIPDTDLV------FTGIYAMILQVGWLAIVFIALFVFELLFCK-LYWLIF-TSPFKKFTNICLSQNI 629  Tricho...
CBZ12062             708 FLLGLDYQNMSASVPRGS----RQVdGMTVSFDTLRIAIDTFFWVAVALVMYLFEYQIYYRFVvVHPLQAFVDLCSVSNI 783  Leishm...
Q4DL05               728 FLVGLNYLKYTESVPVTS----GADeAGTYSLTVMRIALGTFFWVSVSLVLNILEFQIYYRFFcVHPLQAFVDLCSVSNI 803  Trypan...
Q57UB2               685 FLSGLNYVRYAESVPIDS----APGgVGVYQVTTLRFALVTLVCIIVFVVVHVLEFQFYYRFVcVHPLQSFVDLCSVSNI 760  Trypan...
NP_001097846         683 GYQF--LERFTKGD------------------IFLRCCLIAAAYLLTYLLQIIGHQLFI-----ANPLQKFIDLCSLANI 737  fruit fly
XP_015791560         876 SLFCLLYQRFGFYIHGRSPNGRADVNMKEMHELLKR-------EEDDLCSKRGLLPNT--------DQQTFEMLLPTSIN 940  two-sp...
XP_002054171         725 SLFSLLEPGYGYYIHGRSPHGFADTDMSSMILQLQR-------ETQNMCGRRGLLIDS--------DKQAYIILPPRNLR 789  Drosop...
WGS:AAQB:GK22712-PA  727 SLFTLKEPGFGYYIHGRSPHGFADTDMSSMILQLQR-------EAQNMCGRRGLLMDS--------DKQAYVILPPRNLR 791  Drosop...
A0DDG3               723 SIFILDDNLHGYYIHGENPLGFSEGGIPHLQECLRN-------ESKNKGKNRGLVKDGyd-----sQLCTYELFVPPEFK 790  Parame...
A0BV64               670 SILILDDVLHGYYIHGENPIGYAEGSSEHLANCLHY-------EALGKGKKRGFIQESslqhsddvDLQTFELFLPMRFR 742  Parame...
XP_001317146         630 SVLITDSTVHGHYIHGLT--KDTEKSMIELQLSASQrlntkpaEQQNSQTQSFIMIDM--------KSNCFETYFEPELS 699  Tricho...
CBZ12062             784 SIIILLEQQWGFYIHGESIHAHADVSMEEFQSNLFL-------EAQGNLPVRGLGGQS--------KCQSLEVYLGPYTR 848  Leishm...
Q4DL05               804 SIMILPETQWGYYIHGESIHAHSDVSMEEFQQNLYL-------ESQGNLPVRGLGGQS--------KCQTFEVFMGIYMR 868  Trypan...
Q57UB2               761 SVLILPEEQWGYYIHGESIHAHSDVSMEEFQQNLCL-------EAQGDLPVRGLGGQS--------ECQTFEVFMGVHTR 825  Trypan...
NP_001097846         738 SLFSLTEPGFGYYIHGRSPHGFADTDMSSMILQLQR--------TQTMCGRRGLLMDS--------DKQAYVILPPRNLH 801  fruit fly
XP_015791560         941 DQCNRI-RALLTTYSQGAERMQgvggh---------------lfkvDLEKVVPTYVM-LTKFLSGYIEHAFK--DADYTV 1001 two-sp...
XP_002054171         790 IYLDRL-LLPFQRSRNGSMSQTllyqkdl----------pissidgQVERTSIAYAS-INRFFCAFIDHAIK--DMDYII 855  Drosop...
WGS:AAQB:GK22712-PA  792 IYLDRL-LLPFQRSAHGSMSQTllyqkd------------ipsidgQVERTSIAYAS-VNRFFCAFIDHAIK--DMDYII 855  Drosop...
A0DDG3               791 HQFEVN-YQGIRNYKEKREMKSl----------------------gIENVELQKFK--IEQFLKSKINEVKKvdKRANFI 845  Parame...
A0BV64               743 EAYEKVyNQELKQKTDNAQYQNyneirvl----------rqgvpdgLDMALVQAIKDtFSFYLKDVLTQVRT--NFAKCV 810  Parame...
XP_001317146         700 RRIFDI-YNSVSAQVGGSLFKqaa--------------------asLAQVCIGIYSD-LNKFLQQFFTPGAT--NFKLEL 755  Tricho...
CBZ12062             849 QYLYMC-YIEMHIENQRSLLKRerainpaqwhyi-rflfcfsrqlcVYTQTALAIRDrINYAFQQSVRRAES------TV 920  Leishm...
Q4DL05               869 QYLYMC-YAEIEAEYQRSSGKAlapirpgrqwhllecvlgfsrksrVYNTEILAIKTrINSVLKQSVRSAEG------TL 941  Trypan...
Q57UB2               826 QYLYVC-SASIEEEQQRALGKPpspvytgkkwhflkclfgvsrkprAYDSGTLALKKlINDTLRKSIRRAEG------TL 898  Trypan...
NP_001097846         802 IYLERL-LLPFQRSLTGTLSQTmlyqkdi-----------vpsidgQMERTSIAYAS-VNRFFCAFIDHAIK--DMDYII 866  fruit fly
XP_015791560        1002 K-DKSNVESILAFELAE-PGE---------RGFLYNDNGHSFDQLLFCGNEFKLFTFEFMLFIFIDLITHNFVAAATFTF 1070 two-sp...
XP_002054171         856 K-ERTLLEKLFNCEIENyLTEn--------KGTFYIDDSLSFSRVLLLGNHVHIFVLELLVLLSMYLLTSSLLFAAAIAC 926  Drosop...
WGS:AAQB:GK22712-PA  856 K-EKSVAEKLFNCEIENyLTEn--------KGTFYIDDSYSFSRLLLLGNHMDIFVLEILLLLSLFLLSGNLLISAAAAC 926  Drosop...
A0DDG3               846 R-TKETAQRYFDYPPDElAYDdfn---ksqVPYFYKDPDYQYRRVFFSGYEMYFLVTDIIIFTFFVLVTQNVALSILLQY 921  Parame...
A0BV64               811 R-DKLPVQRFFDYPPADlEENyfk---dqsMPVFFRDPDQSFKSMFFCGHEFFFLITDTMIFNFWMILTNNTYLSLMLTY 886  Parame...
XP_001317146         756 HyEIPVARRIFGMAPT--ITD---------SSILDKTSGEHYRFMLFYGLQVRLYFTYSLLFCIIDMFLKNPVVAGFIVL 824  Tricho...
CBZ12062             921 L-VKFMLQKWLDFPPNVmYMNgpqrgdhcgKDLFFIDDVQSYGRAFLCGLDFDLFVLYAALFAAIDAALHNFYVAMVLAF 999  Leishm...
Q4DL05               942 L-MKFIFHRWFDLAPNIlYMNgpqsgdksgKDLFFVDDVLAYGNAFLYGLDVDLFVLYTMLYASVDASMHNVWVALVITF 1020 Trypan...
Q57UB2               899 L-SKSVMHGSLDIAPNVlYMNgpqsgdkagKDVFFVDDVTAYGKAFLYGMDIDLFIFYMMLYASVDVATHNLFYAFAITF 977  Trypan...
NP_001097846         867 K-EKSFVEQLLNCEIDNyITEn--------RGTFYIDDSFSFSRVLLLGNHLHIFVLELLLVLSIFLMTSNLLIAAAGAC 937  fruit fly
XP_015791560        1071 LIIEIIKSIYIVAYKRNIVKKALIDERFLM 1100 two-spotted spider mite
XP_002054171         927 GLNMLVRHTFKHWARRNVSRKTLIDERFLL 956  Drosophila virilis
WGS:AAQB:GK22712-PA  927 GFNMLIRHIFRFWVRRNVSRKTLIDERFLL 956  Drosophila willistoni
A0DDG3               922 FVTKSFEWLKQEWQKSNISEKTKIDKRFLI 951  Paramecium tetraurelia
A0BV64               887 LISAGIFNFRQWVGERNLADQSKIDSRFLI 916  Paramecium tetraurelia
XP_001317146         825 VVDYLVLKFVRFRCKQNLAKKSLLENRFLy 854  Trichomonas vaginalis G3
CBZ12062            1000 AVEVVVHFYRVREGLANLSQKTMIDDRFFL 1029 Leishmania major strain Friedlin
Q4DL05              1021 ALELSIRWYRMSEGVANISSKTLIDDRFFI 1050 Trypanosoma cruzi
Q57UB2               978 AVEFLLRWYRMTEGVVNISSKTLIDDRFFI 1007 Trypanosoma brucei
NP_001097846         938 ALNILLRQVFRHWVRRNISRKTLIDERFLL 967  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap