Conserved Protein Domain Family
Tmem26

?
pfam09772: Tmem26 
Transmembrane protein 26
The function of this family of transmembrane proteins has not, as yet, been determined.
Statistics
?
PSSM-Id: 370678
View PSSM: pfam09772
Aligned: 8 rows
Threshold Bit Score: 324.742
Threshold Setting Gi: 156227119
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3UP23         3 GLVLLKALVTRLLFLLHSLVAVWRVTWVK-EEHRYWLLALLNLLLVLETVLTLKFKRGRGYKWLSPAIFVYLVNIMPSLW 81  house mouse
Q65XY1        30 LISCLRAILARGIFIVHSIVTIRQTVLIS-ERESVWGFALLSLLIVFEGGYAIIMRAGDERKWFCTSVFLYIVATAPPIW 108 Caenorhabditis ...
Q17BX0         4 LLATIKAIITRIIFSAHGFIAIWQVTQNK-KDPLYWCLCVPIGVLFVEGIFTLAIKKNQEWRWFCPSVFIYLSTIVPAIW 82  yellow fever mo...
Q9VBE7         4 IISTIKAILTRIIFSAHSLLAIWQVVALK-SDIIYWALCGPLLLLLLEGIFTIMIKKTQEWRWFCPSVFLYLSSIVPAIW 82  fruit fly
Q6ZUK4         3 GLVFLNALATRLLFLLHSLVGVWRVTEVK-KEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLISIVPSLW 81  human
EDO47924       4 IFHYLAALFSRFLFLIHAVLMICWLVLVK-DNNLYFIFVSLLVALVIETFITVGFRKGHEYAGFCPSMFLYLLAVIPCDW 82  starlet sea ane...
EDO48561       5 FFKFASALFTRVIFFVHGFVSVYLVWLSKnKDSTYWWLSTGLVLLFFETIYTILMRKGKEYKYFWPSSLLYMATVLPSIW 84  starlet sea ane...
XP_001624860   3 VFALFAAFFTRVLFSVHVLLSVGLVVLHT-KQPLYWAFLLGLVALVCEMLYVMIVRKGAEYKYFWPSCFLYISAIIPVVW 81  starlet sea ane...
Q3UP23        82 LLEMHHGNQYcstqs--------------------ermaQNFSRRGDVNQTLSSHRATNgmgnilelargfvdnlsmVCE 141 house mouse
Q65XY1       109 ILETRICNWR-----------------------------TNMEKNTEGFETLQHPVALK------------------DNS 141 Caenorhabditis ...
Q17BX0        83 LLELDKLEKRtlfqdqvl--------------netinfaATVGKDLKDLNKMLG-VKIQlpe-------------iqLNA 134 yellow fever mo...
Q9VBE7        83 LLELDKVARRvgnmtstnstvyspsnysipvgnttifitSTNSSGVPPVATLLGQAGVTl----------------sVTP 146 fruit fly
Q6ZUK4        82 LLELHHETQYcsiqa--------------------egtsQNTSRKEDFNQTLTSNEQTSraddlietakvfvnnlstVCE 141 human
EDO47924      83 ITKRAVINFF----------------------------------------HIFQALGSVyk---------------sQDD 107 starlet sea ane...
EDO48561      85 VAEMSILHAKqt-------------------------dpNCESNSASTVYALGGGVGIAp-----------------TWN 122 starlet sea ane...
XP_001624860  82 VMELDLLRHRldkrd-------------------qltlrLSGSNTIDTSGLNIDGIGIAat---------------iQVD 127 starlet sea ane...
Q3UP23       142 PVWTLGLHQTLLLILIIGRWLLPIGGtITRDQLSELLLMFVGTAADILEFTtETLKENNVR-----TNPTLVSGILVVWT 216 house mouse
Q65XY1       142 ELRLQLLEQLLLVNLIVGRWLLPKGD-ISREQLSQILLAYLAISSDIVEFF-DVFKEKVVY-----SNSRVQTIVLTAWT 214 Caenorhabditis ...
Q17BX0       135 DTWVTLIEQFLMLVLIIGRWMLPKGD-LTRDQLSQLLLVYIGTAADIIEFF-DSFKDSKIA-----NEPVLVLLTLSIWS 207 yellow fever mo...
Q9VBE7       147 DTWTTLIEQFLMLILIVGRWLLPKGD-LTRDQLSQLLLVYIGTAADIIEFF-DSYKDDSIA-----KIGFLVFLTLGIWS 219 fruit fly
Q6ZUK4       142 KVWTLGLHQTFLLMLIIGRWLLPIGGgITRDQLSQLLLMFVGTAADILEFTsETLEEQNVR-----NSPALVYAILVIWT 216 human
EDO47924     108 EAVLYTLEQALVLILVIGRWLLPKGS-ISRDQLSQLLLVYVGMAADIMEFT-EIIKEDEIRkvnmlNNNHFVNAVILFWS 185 starlet sea ane...
EDO48561     123 TLTQKWSKLGLILVIIVARWLLPRGE-LTRDQLSTLLLVYVANAADIMGELsAEVPQAQLA-----AKTLYLVSVLVTYT 196 starlet sea ane...
XP_001624860 128 TAAKKVCELGVVVIIIVGRWLLPRGR-MTRDQLSNLLLCYIGMGADILELF-AALTEPEVM-----HNASVTYATLALFS 200 starlet sea ane...
Q3UP23       217 WSMLQFPLDLAVQLKLVCPASVKARGFLR--------VFLCQYSADLWAIGLSFFIQDGPFLVVRLVLMIYFKVINHMLV 288 house mouse
Q65XY1       215 LSLLQFPFVLTVSRARKMRVAITNDYEQLfarqrprsCFKAFYDVDIWAIFLANVLQDVPFLLVRLYLMTVHNLITYTMI 294 Caenorhabditis ...
Q17BX0       208 WSLLQFTIVLSATRARKPRGGGSAASQREedt---hcCNMSCCNIDVWGIALNILLQDAPFLTFRLLIIIHYKIITYMNI 284 yellow fever mo...
Q9VBE7       220 WSLMQFTIVLSATRGRRPRGSGSHHKEEHtd-----cCQNCCCGIDVWGIVLNVILQDAPFLTFRLLIIFQYKIINYMNV 294 fruit fly
Q6ZUK4       217 WSMLQFPLDLAVQ-NVVCPVSVTERGFPS--------LFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLV 287 human
EDO47924     186 MSLFQFTLTISGTERTAQLNEY----------------------IELVSLLVPMLMQDGPFLIIRLIAIAYYEVNHDTLY 243 starlet sea ane...
EDO48561     197 WCFMQFTLVFTATAKSEPDEVTKQVTSKTks-----qEKKLRLHGDLYSILTIMLMQDGPFLVLRLVMLVQFRVDSEMHL 271 starlet sea ane...
XP_001624860 201 WSMFQFCVVATATVGGSEESPDITHQPSE--------VSTSIVDFKKKKHLAALFMQDGPFLLLRLSLLIGYGVSSEIHI 272 starlet sea ane...
Q3UP23       289 FFAVKNSLVMALHFYR 304 house mouse
Q65XY1       295 FFFFKNMLIILLQTYR 310 Caenorhabditis elegans
Q17BX0       285 FFTCKNTLVILLQLYR 300 yellow fever mosquito
Q9VBE7       295 FFTCKNSLVIILQLYR 310 fruit fly
Q6ZUK4       288 FFAAKNFLVVVLQLYR 303 human
EDO47924     244 FLTVKNALVIMLQIYR 259 starlet sea anemone
EDO48561     272 FFTGKNAMALAVLFYR 287 starlet sea anemone
XP_001624860 273 FFTAKNALTVVIMLYR 288 starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap