Conserved Protein Domain Family
Tmemb_18A

?
pfam09771: Tmemb_18A 
Transmembrane protein 188
The function of this family of transmembrane proteins has not, as yet, been determined.
Statistics
?
PSSM-Id: 401646
View PSSM: pfam09771
Aligned: 20 rows
Threshold Bit Score: 167.83
Threshold Setting Gi: 308240875
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFO84827      16 DLRFFERRLTEVITYMGPSCTRWRITIVVFAVIIGVIGSKYVTREvvgffgyladftfvfqniEQFETSISHFLFTtHLD 95  Caenorhabditis ...
CDI97262      23 DLKAFERRLREIVDGLRPRAKLWRIILLAATVFWLSATYLWLTDP------------------LTYQVNFITSLGK-HPC 83  Echinococcus mu...
1_pfamImport   5 DLKSFERRLTEVVTCYQPAAKKWRIILAVIASATAIGAYYWLKDP------------------DTSIVPFNESLFN-HKI 65 
XP_001966403  11 DLRAFERRLGEMVASEKPSKCRGGLLMGAIVTCTAVGSCHWLEEA------------------RESKSLIFRALAS-QGV 71  Drosophila anan...
XP_002009049   8 DLKAFERRLTEVVSSYRPPTYRWRIILSALSVCTAISAWYWLKDP------------------RTTVVPLTESLWI-HPI 68  Drosophila moja...
XP_001957823   8 DLKAFERRLTEVVSSYRPSTFRWRIVLSAMSMCTAISAWYWLRDP------------------RTVSVPLTESLWI-HPV 68  Drosophila anan...
Q175U5        10 DLKAFERRLTEVIAALQPSTLRWRILLCTMSLITFVGAFYWLTDP------------------RTSIVPLMDSLWN-HPV 70  yellow fever mo...
XP_015793005  10 DLKAFERRLQEMMNCMKLQTKRYRLVLAVITAFTAFGAFQWLTDP------------------LTSRISLFQSLFN-HPF 70  two-spotted spi...
XP_001949038  10 DLKAFERRLTEVIASIKPITNRWRTILAISTLSASIGAYYWLTDP------------------QTAKVSFVQSLYN-HLL 70  pea aphid
EGT33413      18 DLKFFEKRLTEVITYMGPSCTRWRFTIVIFAVIVGVTASKYLSSEk----------------wEFFQVPLLDLLIStHLD 81  Caenorhabditis ...
EFO84827      96 FTICVCVGFLLFgLLGVHRRIVAPTIVARRCRDALAPFSLSCD-HNGKLIVKPAV 149 Caenorhabditis remanei
CDI97262      84 FAVSACLMIGLF-LVGAHKKVVLPSIIAQRCRTVLVEYNMTCD-NSGKLILLPRP 136 Echinococcus multilocularis
1_pfamImport  66 FSLAIISLIMLF-LAGVDNLVIAPKIITSRTRTVLSNYNMSCD-DTGKLILRPRP 118
XP_001966403  72 FVISMASLVLLL-IFGFKRVSQKDMPILRNMRSILNIFRIQCD-DDGHLILIPSs 124 Drosophila ananassae
XP_002009049  69 FTVATVTLIILF-IFGIQKLVVAPQIITSRTRSVLTDFALDLEpHTGKLILKPRQ 122 Drosophila mojavensis
XP_001957823  69 FTIATLTLIVLF-ILGIQKLVIAPQIITSRTRTVLGDFNMSCD-DTGKLILKPRQ 121 Drosophila ananassae
Q175U5        71 FTFSTAILLLLF-VFGIHKLVMAPQIITSRTRSVLAEFNMSCD-ETGKLILRPRP 123 yellow fever mosquito
XP_015793005  71 FTINAFILILLFaLTGIHKRVIAPQVIMSRVRQVLSDFNMTCD-DNGRLILKPRP 124 two-spotted spider mite
XP_001949038  71 FTISSIMLMILL-LTGVHKKVIATSIITSRARQVLADFNMSCD-DSGKLILRPRP 123 pea aphid
EGT33413      82 FTVCVIAGLLLFgVLGVHRRIVAPTIVSRRCREALSPFNLSCD-HNGKVFLRPAR 135 Caenorhabditis brenneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap