Conserved Protein Domain Family
Atx10homo_assoc

?
pfam09759: Atx10homo_assoc 
Spinocerebellar ataxia type 10 protein domain
This is the conserved C-terminal 100 residues of Ataxin-10. Ataxin-10 belongs to the family of armadillo repeat proteins and in solution it tends to form homotrimeric complexes, which associate via a tip-to-tip association in a horseshoe-shaped contact with the concave sides of the molecules facing each other. This domain may represent the homo-association site since that is located near the C-terminus of Ataxin-10. The protein does not contain a signal sequence for secretion or any subcellular compartment confirming its cytoplasmic localization, specifically to the olivocerebellar region.
Statistics
?
PSSM-Id: 401636
View PSSM: pfam09759
Aligned: 82 rows
Threshold Bit Score: 107.546
Threshold Setting Gi: 74830132
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013934336 451 VKLIIVEIITALVYENFENQELMRNVHG-LELILNNCNLDAHEPFIKERAILCIKYLLLDNPRNQEFVAKLE--AKGT-S 526 Ogataea parapol...
Q57UY3       197 FRREHVRLVANLTYENKEVCSAVLGDTRlLTAILGATRIDLENPGMGEWATFVIRNLCYCSNEAREILRGLT--PISIvE 274 Trypanosoma brucei
Q4CUL6       198 YRTEHMRLMANLTLDNVEACSFIVSNSAlLAAVLTSTRFDEENPGMVEWAEFCIRNLCCCTKEAHEKIRRLM--PVGIsD 275 Trypanosoma cruzi
Q4QH91       199 FKTECMRLIANLTHNNVDVNAALVERDTfLFNILSATQIDEENPGMVEWAEFALRNICESSAAAREKIRKLA--PQGVtD 276 Leishmania major
EGD72293     565 mvRDVIRLIANLAYLCRANQDTFRQLEG-FPPLLERFLHDDNNPFIREWATVAVRNLCEGNEDNQALLRATErvPKDV-I 642 Salpingoeca ros...
XP_005844246  38 FRTDLLAAVANATYGRPAVQSEVCALGG-VELVLAQCQLDRHSPLAREWALWGVRNLCEGNAQAQEAIRQLQ--LCTT-V 113 Chlorella varia...
XP_003062424 541 YRVDALAPLANAMFNRPGVCDQVVKLGG-VPIILAATRGEDGEDFLREWALWATRNLCHGSEDARKEIESMQ--PEAA-A 616 Micromonas pusi...
XP_002501343 540 YRVDCVAPLANAMFARPLVCNQVAKLGG-VAIVLAATRGEDGDDYLREWALWGVRNLCAGSDVARGEIERMQ--PQAA-A 615 Micromonas commoda
CBN74448     518 RKVELLKVIGNACFRCRRSQDLVREEGG-LPLVLNHCKVDEANPLLREYALLALRNLCEGNAANQASISSLQ--PQGct- 593 Ectocarpus sili...
EEY53311     366 YRSGLIRVIGNLSFRHTDHQDLVRNEGY-LPLFLNHCNIDETNPMIREWSLVALRNLCEGNEANQSYINALR--PQGMdA 442 Phytophthora in...
XP_013934336 527 idpkNEAILEQA-GFEVNI-ED-GKVKLK 552 Ogataea parapolymorpha DL-1
Q57UY3       275 ----EADELFGK-AVDPHAtPE-GRSAME 297 Trypanosoma brucei
Q4CUL6       276 ----ESKELLSSgRVDCHLnSE-GKLVLS 299 Trypanosoma cruzi
Q4QH91       277 ----QSREILAG-RCSYSFsST-GKVQLH 299 Leishmania major
EGD72293     643 ----NKEELQSIyGVDVEIdEAsGRLRVK 667 Salpingoeca rosetta
XP_005844246 114 ----DNEELKRM-GVRMELdEHsGKLRVi 137 Chlorella variabilis
XP_003062424 617 ----DSQELAAM-GLNVSVdPAtGKVRVK 640 Micromonas pusilla CCMP1545
XP_002501343 616 ----DSQQLAAM-GLNVEVdPGtGRVRVg 639 Micromonas commoda
CBN74448     594 --pgMEEALADM-GLEGSVnAE-GKFAVg 618 Ectocarpus siliculosus
EEY53311     443 a---STTTLDKA-KMRADIgKD-GNVKLT 466 Phytophthora infestans T30-4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap